SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g31343): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g31343): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g31343

Feature Type:gene_model
Chromosome:Gm12
Start:34930415
stop:34931595
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g31343
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G30700AT Annotation by Michelle Graham. TAIR10: Pentatricopeptide repeat (PPR) superfamily protein | chr4:14962617-14964995 REVERSE LENGTH=792 SoyBaseE_val: 5.00E-17ISS
GO:0000963GO-bp Annotation by Michelle Graham. GO Biological Process: mitochondrial RNA processing SoyBaseN/AISS
GO:0016554GO-bp Annotation by Michelle Graham. GO Biological Process: cytidine to uridine editing SoyBaseN/AISS
GO:0080156GO-bp Annotation by Michelle Graham. GO Biological Process: mitochondrial mRNA modification SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR24015Panther FAMILY NOT NAMED JGI ISS
PF01535PFAM PPR repeat JGI ISS
UniRef100_I1LTY9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LTY9_SOYBN SoyBaseE_val: 1.00E-76ISS
UniRef100_Q2HSJ7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pentatricopeptide repeat-containing protein n=1 Tax=Medicago truncatula RepID=Q2HSJ7_MEDTR SoyBaseE_val: 4.00E-44ISS

Expression Patterns of Glyma12g31343
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g31343 not represented in the dataset
Glyma12g31343 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g31343 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g187900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma12g31343
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g31343
>Glyma12g31343.1   sequence type=CDS   gene model=Glyma12g31343   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGCTTGCTCATAAACCCTTTGATCGTCACACCTTACCCGTGGTGCTCAAATCTTGTGCTGGCTTATCGGCTCTGCGGCTCGGGCAACAAGTCCATGGAGCAGTTTTGGTTAATGGGTTTGGCTTAGATTTGGCAAATTCGAATGCTTTGATGAACATGTATGGTAAGGGCGGACATTTGGTATGTGCACGCAAGGTGTTTGATAGAATGTGGAAAAGGAATGAGATTGCGTTTTCAACTATGATGGCGGGTTATGGAATGCATGGAAAGTGTGGGGAGGTGTTTGATAGAATGGTGGAGGCAGGGGAGGCCAGATGGTGTGACTTTTACGGCAGTTTTGAGTGCATGTAG
Predicted protein sequences of Glyma12g31343
>Glyma12g31343.1   sequence type=predicted peptide   gene model=Glyma12g31343   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVLAHKPFDRHTLPVVLKSCAGLSALRLGQQVHGAVLVNGFGLDLANSNALMNMYGKGGHLVCARKVFDRMWKRNEIAFSTMMAGYGMHGKCGEVFDRMVEAGEARWCDFYGSFECM*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo