|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT4G30700 | AT | Annotation by Michelle Graham. TAIR10: Pentatricopeptide repeat (PPR) superfamily protein | chr4:14962617-14964995 REVERSE LENGTH=792 | SoyBase | E_val: 5.00E-17 | ISS |
GO:0000963 | GO-bp | Annotation by Michelle Graham. GO Biological Process: mitochondrial RNA processing | SoyBase | N/A | ISS |
GO:0016554 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cytidine to uridine editing | SoyBase | N/A | ISS |
GO:0080156 | GO-bp | Annotation by Michelle Graham. GO Biological Process: mitochondrial mRNA modification | SoyBase | N/A | ISS |
GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
PTHR24015 | Panther | FAMILY NOT NAMED | JGI | ISS | |
PF01535 | PFAM | PPR repeat | JGI | ISS | |
UniRef100_I1LTY9 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LTY9_SOYBN | SoyBase | E_val: 1.00E-76 | ISS |
UniRef100_Q2HSJ7 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Pentatricopeptide repeat-containing protein n=1 Tax=Medicago truncatula RepID=Q2HSJ7_MEDTR | SoyBase | E_val: 4.00E-44 | ISS |
Glyma12g31343 not represented in the dataset |
Glyma12g31343 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.12g187900 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma12g31343.1 sequence type=CDS gene model=Glyma12g31343 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGTGCTTGCTCATAAACCCTTTGATCGTCACACCTTACCCGTGGTGCTCAAATCTTGTGCTGGCTTATCGGCTCTGCGGCTCGGGCAACAAGTCCATGGAGCAGTTTTGGTTAATGGGTTTGGCTTAGATTTGGCAAATTCGAATGCTTTGATGAACATGTATGGTAAGGGCGGACATTTGGTATGTGCACGCAAGGTGTTTGATAGAATGTGGAAAAGGAATGAGATTGCGTTTTCAACTATGATGGCGGGTTATGGAATGCATGGAAAGTGTGGGGAGGTGTTTGATAGAATGGTGGAGGCAGGGGAGGCCAGATGGTGTGACTTTTACGGCAGTTTTGAGTGCATGTAG
>Glyma12g31343.1 sequence type=predicted peptide gene model=Glyma12g31343 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MVLAHKPFDRHTLPVVLKSCAGLSALRLGQQVHGAVLVNGFGLDLANSNALMNMYGKGGHLVCARKVFDRMWKRNEIAFSTMMAGYGMHGKCGEVFDRMVEAGEARWCDFYGSFECM*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||