SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma12g31250

Feature Type:gene_model
Chromosome:Gm12
Start:34823804
stop:34825450
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G06270AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 11 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G11600.1); Has 1807 Blast hits to 1807 proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink). | chr5:1912895-1913263 FORWARD LENGTH=122 SoyBaseE_val: 5.00E-17ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1LTY3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LTY3_SOYBN SoyBaseE_val: 1.00E-74ISS
UniRef100_Q9FNI1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Gb|AAF02129.1 n=1 Tax=Arabidopsis thaliana RepID=Q9FNI1_ARATH SoyBaseE_val: 2.00E-14ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g187100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma12g31250.1   sequence type=CDS   gene model=Glyma12g31250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGCAAAAGAAAGGGTCCAAGCTCAGAATTGAGGCAACCGAACATGCCAACATCGCCGCCGGAGGTTGTTGAATCATCATCAGGTGAGTTGCCAGAAGAGTTTTCTTGGTCATCGTGTCTATCTTCTTCGGTGTCATCTTCATCAAAGATACCAATTGAGGATGAAGAGAATGTGCAACGTGCAAATGCTTCTCCAGAAACAAAAGCCATGGATCTCGTTGGTTGTCCTCGATGCTTCATGTACGTCATGTTATCCGAGGTGGATCCAAAGTGCCCTAAGTGCAAGACCACAGTGTTTCTTGAACTTTTCAAAGATGAAAACTTCAACCCAGATAATTAA

>Glyma12g31250.1   sequence type=predicted peptide   gene model=Glyma12g31250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCKRKGPSSELRQPNMPTSPPEVVESSSGELPEEFSWSSCLSSSVSSSSKIPIEDEENVQRANASPETKAMDLVGCPRCFMYVMLSEVDPKCPKCKTTVFLELFKDENFNPDN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo