SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g30125): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g30125): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g30125

Feature Type:gene_model
Chromosome:Gm12
Start:33703308
stop:33704940
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g30125
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G05160AT Annotation by Michelle Graham. TAIR10: AMP-dependent synthetase and ligase family protein | chr4:2664451-2666547 FORWARD LENGTH=544 SoyBaseE_val: 5.00E-33ISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009695GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0005777GO-cc Annotation by Michelle Graham. GO Cellular Compartment: peroxisome SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004321GO-mf Annotation by Michelle Graham. GO Molecular Function: fatty-acyl-CoA synthase activity SoyBaseN/AISS
GO:0016207GO-mf Annotation by Michelle Graham. GO Molecular Function: 4-coumarate-CoA ligase activity SoyBaseN/AISS
PTHR24096Panther FAMILY NOT NAMED JGI ISS
PTHR24096:SF43Panther SUBFAMILY NOT NAMED JGI ISS
UniRef100_H2BER4UniRef Annotation by Michelle Graham. Most informative UniRef hit: 4-coumarate:CoA ligase n=2 Tax=Glycine max RepID=H2BER4_SOYBN SoyBaseE_val: 8.00E-38ISS
UniRef100_UPI000233C414UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C414 related cluster n=1 Tax=unknown RepID=UPI000233C414 SoyBaseE_val: 5.00E-55ISS

Expression Patterns of Glyma12g30125
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g30125 not represented in the dataset
Glyma12g30125 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g30125 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma12g30125
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g30125
>Glyma12g30125.1   sequence type=CDS   gene model=Glyma12g30125   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ACCCAAAGCTCTCACTCGTTTCTCATCTTTTCAGCAAACTCTTCAGAAACACTTTCATTCGCGGAGCTCAAGTTGTTAACAGTTAAAGTCGCTCACGGCCTTCTTCGTCTCGGAATGACGAAAAACGACGTCGTTGCGCCAGCAGAACTTGAAGGGCTTCTGGTTTCTCGCTCTGAAATACTTGATGCTGTTGTCATTCCATATCCTGATGCTGAAGTTGGCGAGGTTCCAGTTGCCTATGTCTTTCGTTCACCCAATAGTTCACTAACAGAGGAAGGCGATCAAAAATTTGCTAAGCAGGTAGCGCCTTTCAAAAGATTACTAAGAGTGACATTCATCAATGCTGTTCCTAAGACAGCATCGGGAAAATTCTTCAAAGGGAGCTTATTGAGAAAGTAA
Predicted protein sequences of Glyma12g30125
>Glyma12g30125.1   sequence type=predicted peptide   gene model=Glyma12g30125   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TQSSHSFLIFSANSSETLSFAELKLLTVKVAHGLLRLGMTKNDVVAPAELEGLLVSRSEILDAVVIPYPDAEVGEVPVAYVFRSPNSSLTEEGDQKFAKQVAPFKRLLRVTFINAVPKTASGKFFKGSLLRK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo