Glyma12g29620 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g29620

Feature Type:	gene_model
Chromosome:	Gm12
Start:	33062858
stop:	33064247
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma12g29620

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G13720	AT	Annotation by Michelle Graham. TAIR10: Inosine triphosphate pyrophosphatase family protein \| chr4:7967166-7968894 REVERSE LENGTH=206	SoyBase	E_val: 7.00E-16	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0016462	GO-mf	Annotation by Michelle Graham. GO Molecular Function: pyrophosphatase activity	SoyBase	N/A	ISS
GO:0016787	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity	SoyBase	N/A	ISS
UniRef100_C6TC28	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TC28_SOYBN	SoyBase	E_val: 1.00E-14	ISS
UniRef100_Q8L968	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Inosine triphosphate pyrophosphatase n=1 Tax=Arabidopsis thaliana RepID=ITPA_ARATH	SoyBase	E_val: 3.00E-13	ISS

Expression Patterns of Glyma12g29620

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g29620 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.12g173400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma12g29620

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma12g29620

Limit To All Plant Sequences

>Glyma12g29620.1   sequence type=CDS   gene model=Glyma12g29620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCACTTCTTGGGCAATTCCATTCCTTTTCAGTCCCTCAAACTTGACTTGCCAGAGTTGCAAGGAGAACCTGAAGATATGTCCAAAGAGAAGGCTCGAATTGCTGCTCTTCAGGTGCATTGGCTTCCAGTGGATATAATTTTCTCTTTCACCCTTAACCATTCTGCAGGGCCTTACATGAAATTGGGGCCTTTGGGCATTGGGAGGCACAGACCCTCTAAGTGTGCTCTCTGTTCAGTGATTTGGGGAACATTCTCCTTAATGTTTTTTATCTATCCTGGCTTTCCCATGGGAAAAAGAACAGATACAAATTGGAACGTGAGAGATATTGTTTTTGTTTGCATCTAA

Predicted protein sequences of Glyma12g29620

Limit To All Plant Sequences

>Glyma12g29620.1   sequence type=predicted peptide   gene model=Glyma12g29620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHFLGNSIPFQSLKLDLPELQGEPEDMSKEKARIAALQVHWLPVDIIFSFTLNHSAGPYMKLGPLGIGRHRPSKCALCSVIWGTFSLMFFIYPGFPMGKRTDTNWNVRDIVFVCI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain