SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma12g29620

Feature Type:gene_model
Chromosome:Gm12
Start:33062858
stop:33064247
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G13720AT Annotation by Michelle Graham. TAIR10: Inosine triphosphate pyrophosphatase family protein | chr4:7967166-7968894 REVERSE LENGTH=206 SoyBaseE_val: 7.00E-16ISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0016462GO-mf Annotation by Michelle Graham. GO Molecular Function: pyrophosphatase activity SoyBaseN/AISS
GO:0016787GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity SoyBaseN/AISS
UniRef100_C6TC28UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TC28_SOYBN SoyBaseE_val: 1.00E-14ISS
UniRef100_Q8L968UniRef Annotation by Michelle Graham. Most informative UniRef hit: Inosine triphosphate pyrophosphatase n=1 Tax=Arabidopsis thaliana RepID=ITPA_ARATH SoyBaseE_val: 3.00E-13ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g173400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma12g29620.1   sequence type=CDS   gene model=Glyma12g29620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCACTTCTTGGGCAATTCCATTCCTTTTCAGTCCCTCAAACTTGACTTGCCAGAGTTGCAAGGAGAACCTGAAGATATGTCCAAAGAGAAGGCTCGAATTGCTGCTCTTCAGGTGCATTGGCTTCCAGTGGATATAATTTTCTCTTTCACCCTTAACCATTCTGCAGGGCCTTACATGAAATTGGGGCCTTTGGGCATTGGGAGGCACAGACCCTCTAAGTGTGCTCTCTGTTCAGTGATTTGGGGAACATTCTCCTTAATGTTTTTTATCTATCCTGGCTTTCCCATGGGAAAAAGAACAGATACAAATTGGAACGTGAGAGATATTGTTTTTGTTTGCATCTAA

>Glyma12g29620.1   sequence type=predicted peptide   gene model=Glyma12g29620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHFLGNSIPFQSLKLDLPELQGEPEDMSKEKARIAALQVHWLPVDIIFSFTLNHSAGPYMKLGPLGIGRHRPSKCALCSVIWGTFSLMFFIYPGFPMGKRTDTNWNVRDIVFVCI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo