Glyma12g29471 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g29471

Feature Type:	gene_model
Chromosome:	Gm12
Start:	32910760
stop:	32914918
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma12g29471

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G45210	AT	Annotation by Michelle Graham. TAIR10: Protein of unknown function, DUF584 \| chr3:16557482-16557928 REVERSE LENGTH=148	SoyBase	E_val: 5.00E-41	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF04520	PFAM	Protein of unknown function, DUF584	JGI		ISS
UniRef100_Q9M1T8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: AT3g45210/T14D3_150 n=1 Tax=Arabidopsis thaliana RepID=Q9M1T8_ARATH	SoyBase	E_val: 2.00E-38	ISS
UniRef100_UPI0001B637FE	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0001B637FE related cluster n=1 Tax=unknown RepID=UPI0001B637FE	SoyBase	E_val: 6.00E-105	ISS

Expression Patterns of Glyma12g29471

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g29471 not represented in the dataset	Glyma12g29471 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma12g29471

Paralog	Evidence	Comments
Glyma13g40090	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma12g29471 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma12g29471

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma12g29471

Limit To All Plant Sequences

>Glyma12g29471.1   sequence type=CDS   gene model=Glyma12g29471   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATAAGGCTAGGCCAAAGCCCAACAACAGTATCGTACTGCGAATGTCACAAACATAAGACAAGTCCATTCACAAAAGATTATCCATTATATGAAACTTTCAATGCATCCAACCACAAAGGTGGTTTTATCCGACACAGGAAAACTTCAGCAATTGAACGTTCAAACTCCACAACTAACAAAGATATCGAAAGTGCGATTCGCATGACCAACATTCGAAGAGCAACCTATCGCTTTCTCCCTGCCATGGACACAGATTCTTTCTCCGATTCCAACTTCGAATTCCAGGAATCCGATCTCTACAACTCCGCTCGCGCTAACTCTCCCGAATTTCGCAAATCCGTACGCGCCTCCAGATTTCACAACTACTCTTCCTCCGGCGGCCGCGTCGGTACTCCGGTGTCGCTTCCGGTGAACGTGCCGGACTGGTCGAAGATTCTCGGCGACGAGTTCGGACGGAACCAGAGGAGGAACTACGACGAAGCGCAGAGCGATGAGGAAGATGGAGATGGGAGAGTGCCTCCGCACGAGTTTCTGGCGAAGACGGGAATCGCTTCGTTCTCGGTGCACGAAGGAGTTGGAAGGACTCTCAAAGGACGCGATCTCAGTAGGGTTCGAAACGCGATTTGGGCTAAAACAGGATTCCAGGACTAG

Predicted protein sequences of Glyma12g29471

Limit To All Plant Sequences

>Glyma12g29471.1   sequence type=predicted peptide   gene model=Glyma12g29471   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIRLGQSPTTVSYCECHKHKTSPFTKDYPLYETFNASNHKGGFIRHRKTSAIERSNSTTNKDIESAIRMTNIRRATYRFLPAMDTDSFSDSNFEFQESDLYNSARANSPEFRKSVRASRFHNYSSSGGRVGTPVSLPVNVPDWSKILGDEFGRNQRRNYDEAQSDEEDGDGRVPPHEFLAKTGIASFSVHEGVGRTLKGRDLSRVRNAIWAKTGFQD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain