SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g29090

Feature Type:gene_model
Chromosome:Gm12
Start:32482767
stop:32483888
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g29090
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G60950AT Annotation by Michelle Graham. TAIR10: 2Fe-2S ferredoxin-like superfamily protein | chr1:22444565-22445011 FORWARD LENGTH=148 SoyBaseE_val: 4.00E-61ISS
GO:0009416GO-bp Annotation by Michelle Graham. GO Biological Process: response to light stimulus SoyBaseN/AISS
GO:0009637GO-bp Annotation by Michelle Graham. GO Biological Process: response to blue light SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009767GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport chain SoyBaseN/AISS
GO:0009773GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I SoyBaseN/AISS
GO:0010114GO-bp Annotation by Michelle Graham. GO Biological Process: response to red light SoyBaseN/AISS
GO:0010155GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of proton transport SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0010218GO-bp Annotation by Michelle Graham. GO Biological Process: response to far red light SoyBaseN/AISS
GO:0022900GO-bp Annotation by Michelle Graham. GO Biological Process: electron transport chain SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0051536GO-mf Annotation by Michelle Graham. GO Molecular Function: iron-sulfur cluster binding SoyBaseN/AISS
GO:0051537GO-mf Annotation by Michelle Graham. GO Molecular Function: 2 iron, 2 sulfur cluster binding SoyBaseN/AISS
PF00111PFAM 2Fe-2S iron-sulfur cluster binding domain JGI ISS
UniRef100_G7INP8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ferredoxin I n=1 Tax=Medicago truncatula RepID=G7INP8_MEDTR SoyBaseE_val: 4.00E-65ISS
UniRef100_I1LTF2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LTF2_SOYBN SoyBaseE_val: 9.00E-102ISS

Expression Patterns of Glyma12g29090
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma12g29090
ParalogEvidenceComments
Glyma08g20111 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma12g29090 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g169400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma12g29090
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g29090
>Glyma12g29090.2   sequence type=CDS   gene model=Glyma12g29090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAAGCTCCTCGTTGTTATCTATTTATCTATCTATCAACCAGAAGAAGAAGAAGAAGAAGAAGCAAGAGAGAGAGAGGAGAGAATATGGCGACCACAGGCGCTTTGTGTGGCACTATGTTGAACACCTCCTTCCTGAAGAGGCAGGCATCAGTGAACATGACAAGCTTCAAGGCTAACGCTGCTGTCTTTGGTGTAAAAGGAGGACGAGGAGGTCGTGTGAGGGCCATGGCAACTTACAAGGTGAAGCTGATAACTCCAGAGGGAGAGCAAGAATTTGAATGCCCAGATGATATATACATTCTTGATCAGGCAGAGGAAAATGGCATTGATCTTCCCTACTCATGCAGGGCTGGTTCTTGCTCTGCATGTGCTGCCAAAGTTGTGAGTGGCAAACTGGACCAGTCAGATGGTAGCTTCCTTGATGACGACCAAATTGATGCAGGATTTGTTCTCACCTGCGTTGCTTACCCCACCTCAGATATTGTCATTGAGACTCACAGGGAGGAAGAGCTCACTGCTTAA
Predicted protein sequences of Glyma12g29090
>Glyma12g29090.2   sequence type=predicted peptide   gene model=Glyma12g29090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQAPRCYLFIYLSTRRRRRRRSKRERGENMATTGALCGTMLNTSFLKRQASVNMTSFKANAAVFGVKGGRGGRVRAMATYKVKLITPEGEQEFECPDDIYILDQAEENGIDLPYSCRAGSCSACAAKVVSGKLDQSDGSFLDDDQIDAGFVLTCVAYPTSDIVIETHREEELTA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo