SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g27390

Feature Type:gene_model
Chromosome:Gm12
Start:30948120
stop:30949415
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g27390
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G15250AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G53163.1); Has 409 Blast hits to 218 proteins in 63 species: Archae - 0; Bacteria - 22; Metazoa - 178; Fungi - 77; Plants - 38; Viruses - 1; Other Eukaryotes - 93 (source: NCBI BLink). | chr3:5136503-5137183 REVERSE LENGTH=226 SoyBaseE_val: 4.00E-21ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1LT78UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LT78_SOYBN SoyBaseE_val: 3.00E-138ISS
UniRef100_Q9LE53UniRef Annotation by Michelle Graham. Most informative UniRef hit: Gb|AAF34834.1 n=1 Tax=Arabidopsis thaliana RepID=Q9LE53_ARATH SoyBaseE_val: 1.00E-13ISS

Expression Patterns of Glyma12g27390
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma12g27390
ParalogEvidenceComments
Glyma06g36170 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma12g27390 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.U026200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma12g27390
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g27390
>Glyma12g27390.1   sequence type=CDS   gene model=Glyma12g27390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACAACAACATCACACACCACAAGAAGCCCTCCTCCGGGGACTCCTTCTCCTTCCCTAGCACCCCCACCCTGGACTCGGCCGACTTCGAGTTCGGGTCCCTCACGCCGGACTCGCCCTCCACCGAGCCCTTCGCGGCCTCCCCGGCCGACCACCTCTTCCTCAACGGCCGCCTCCAGCCCCACTACTTCCCTATTACCAGCCGCAACAGCAGCAACAGAGACTCCCTTTTCTCGTCGCGAAGCAACAGCACCAACAGCAGCTGCAGCAGCGCCAGGACAAGCTCCAGCGACAGCTCCGAGCGAAAAGCCTTCCACAACAAGCTCAAGGGTGGTGGCTCACTTAGGGCAAAGACTCAGTCCCATCATCAGGCATATTGTTCCCAGAGGTGGCAGTATATAACTCCGGTGCCAGCCGCATTGAGCCGCGACGGCTCTGTGAGAAGAAGGGGGGACACAAACCAAGGGAAGAAGAAGAAGGACAAAGGAACCAAAAGGAACAACAACAACAATGATAACAATAACAAAAATAAGGGGGTGAGGTTGGGTTTTGGGAGAAGGATTTTGCGGTGGTTTGTGATGGCTTGCAGAGAATGCCATGCCATGGAACCATCGTCCAAGGGTCGTAGTAAAGAGATGTGA
Predicted protein sequences of Glyma12g27390
>Glyma12g27390.1   sequence type=predicted peptide   gene model=Glyma12g27390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDNNITHHKKPSSGDSFSFPSTPTLDSADFEFGSLTPDSPSTEPFAASPADHLFLNGRLQPHYFPITSRNSSNRDSLFSSRSNSTNSSCSSARTSSSDSSERKAFHNKLKGGGSLRAKTQSHHQAYCSQRWQYITPVPAALSRDGSVRRRGDTNQGKKKKDKGTKRNNNNNDNNNKNKGVRLGFGRRILRWFVMACRECHAMEPSSKGRSKEM*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo