|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G08310 | AT | Annotation by Michelle Graham. TAIR10: FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 25 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Histone chaperone domain CHZ (InterPro:IPR019098); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G44780.2); Has 53711 Blast hits to 33687 proteins in 1618 species: Archae - 142; Bacteria - 4400; Metazoa - 24303; Fungi - 6688; Plants - 2484; Viruses - 449; | SoyBase | E_val: 3.00E-10 | ISS |
| GO:0000394 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation | SoyBase | N/A | ISS |
| GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
| GO:0009086 | GO-bp | Annotation by Michelle Graham. GO Biological Process: methionine biosynthetic process | SoyBase | N/A | ISS |
| GO:0009616 | GO-bp | Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing | SoyBase | N/A | ISS |
| GO:0010050 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vegetative phase change | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| UniRef100_Q9LPF3 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: T12C22.5 protein n=1 Tax=Arabidopsis thaliana RepID=Q9LPF3_ARATH | SoyBase | E_val: 1.00E-06 | ISS |
| UniRef100_UPI0002339305 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI0002339305 related cluster n=1 Tax=unknown RepID=UPI0002339305 | SoyBase | E_val: 8.00E-38 | ISS |
|
Glyma12g27011 not represented in the dataset |
Glyma12g27011 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma12g27011.1 sequence type=CDS gene model=Glyma12g27011 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCAAAGAAAATCACTGGCTGGTCTTCGTCGACTCTTGGAGGAAGATCTTAAACTTGATAAATTTACTCTGGATCCTTATAAGAGGTTTGCAAGTCAACAGCTTGATGAGGTATTAGCATCGTCTGAAGTTCCTGAACCTTCAAATAATGTTAAGAAAATTGTTAAGAAAAAACCTAATACCAAAGTAACTAAAAAGGTCAGCAATGAAGAGAACTCTGATACTTCAGATAAGGAGACTGATGAAGAAGAGAGTGAGGAAGATGAAGTTAAACCAAGGAAAAAAATTATTTATTAG
>Glyma12g27011.1 sequence type=predicted peptide gene model=Glyma12g27011 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MQRKSLAGLRRLLEEDLKLDKFTLDPYKRFASQQLDEVLASSEVPEPSNNVKKIVKKKPNTKVTKKVSNEENSDTSDKETDEEESEEDEVKPRKKIIY*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||