SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma12g26256

Feature Type:gene_model
Chromosome:Gm12
Start:29602757
stop:29603442
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G25930AT Annotation by Michelle Graham. TAIR10: Protein kinase family protein with leucine-rich repeat domain | chr5:9050880-9053978 FORWARD LENGTH=1005 SoyBaseE_val: 5.00E-45ISS
GO:0002679GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response SoyBaseN/AISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0035556GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0052542GO-bp Annotation by Michelle Graham. GO Biological Process: defense response by callose deposition SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PTHR24420Panther FAMILY NOT NAMED JGI ISS
PTHR24420:SF789Panther JGI ISS
PF00069PFAM Protein kinase domain JGI ISS
UniRef100_G7KPN7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Receptor-like protein kinase n=1 Tax=Medicago truncatula RepID=G7KPN7_MEDTR SoyBaseE_val: 1.00E-51ISS
UniRef100_I1MQE6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1MQE6_SOYBN SoyBaseE_val: 8.00E-68ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g26256 not represented in the dataset

Glyma12g26256 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g161900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma12g26256.1   sequence type=CDS   gene model=Glyma12g26256   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGTTGTATCTCTAATGAGGATTCTATGTTCCTTGTGTATAAGTATCTTGAAAACCACAACCTAGATAAATGGCTGCACAAGAAGATTAAGTCAAGTTCAGTAAGTAAAGTGGTCCTTGATTGGCCAAAGAGGTTGAAAATAGCCATTGGAATTGTTCAAGGTTTGAGCTATATGCACCTTGACTGTTCACCACCTGTGGTTCATAGAGATATAAAAACAAGCAACATCCTTTTGGATACTCAATTCAATGCAAAAGTTGCTGATTTTGGAGCTAAGATGTTAATCAAGCCAGGGGAACTTAACACCATGTCAGCTGTGATTGGCTCATTTGGCTATATTGCTCCAGCTATATTCTCTGTGTAG

>Glyma12g26256.1   sequence type=predicted peptide   gene model=Glyma12g26256   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCCISNEDSMFLVYKYLENHNLDKWLHKKIKSSSVSKVVLDWPKRLKIAIGIVQGLSYMHLDCSPPVVHRDIKTSNILLDTQFNAKVADFGAKMLIKPGELNTMSAVIGSFGYIAPAIFSV*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo