SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g25726

Feature Type:gene_model
Chromosome:Gm12
Start:28860734
stop:28861671
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g25726
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G63400AT Annotation by Michelle Graham. TAIR10: Pentatricopeptide repeat (PPR) superfamily protein | chr1:23507320-23509053 FORWARD LENGTH=577 SoyBaseE_val: 2.00E-19ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
PTHR24015Panther FAMILY NOT NAMED JGI ISS
PF01535PFAM PPR repeat JGI ISS
UniRef100_G7KKQ1UniRef Annotation by Michelle Graham. Best UniRef hit: Pentatricopeptide repeat-containing protein n=1 Tax=Medicago truncatula RepID=G7KKQ1_MEDTR SoyBaseE_val: 4.00E-30ISS
UniRef100_G7KKQ1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pentatricopeptide repeat-containing protein n=1 Tax=Medicago truncatula RepID=G7KKQ1_MEDTR SoyBaseE_val: 4.00E-30ISS

Expression Patterns of Glyma12g25726
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g25726 not represented in the dataset
Glyma12g25726 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g25726 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g156500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma12g25726
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g25726
>Glyma12g25726.1   sequence type=CDS   gene model=Glyma12g25726   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGATGTTAAGGTTAAGGTATGCTCTTTCCATTCCTAGGTTTCCCTGTTTTCTTGTTTGTTGTCACCCCGCCATAACCCTACACTCTTGGCCTCTACTCTTTCACAATCCTAATGATGTCATTGTCTCATTCAATCGCATGCTTCGTGAGTGTCCTACACCACCCATCTTTCAATTTAATAAGATTTTAGGATCCCTTAAATTGCAATTCCCTGGCATTGTTTCCTTTAACATCGTCATCAATTGTTTTTGTCACCTCCGTCAAATCAACTTGGCTTTTTTTGTATTAGCCGACATTCTCAAAATTGGTTATCACCCCAACACCATAACCTTCAACACATCCTTAGTGGGAATTTCTCCCAATGTTGTCATTTACAATGCTTTAATATATGGTTTCTTTGCGCATCAATTGCAGGAAGTGATTGCTTTGTTTAATAAAATGAAATGGAAAGGCATCAACCCATATGTCTGTACTTTTAATAGACTGGTTGATGCATTTGGTAAGGAAGGAAAGATGAAAGAAGTTAGAAACGTGGGAGTGAGTCCCAATGTAAATGTCTCGCACAACTATTGTCCCAGATATGGTGAAATGATTTCTAGAGGCTTATCATAA
Predicted protein sequences of Glyma12g25726
>Glyma12g25726.1   sequence type=predicted peptide   gene model=Glyma12g25726   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSMLRLRYALSIPRFPCFLVCCHPAITLHSWPLLFHNPNDVIVSFNRMLRECPTPPIFQFNKILGSLKLQFPGIVSFNIVINCFCHLRQINLAFFVLADILKIGYHPNTITFNTSLVGISPNVVIYNALIYGFFAHQLQEVIALFNKMKWKGINPYVCTFNRLVDAFGKEGKMKEVRNVGVSPNVNVSHNYCPRYGEMISRGLS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo