SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g25160

Feature Type:gene_model
Chromosome:Gm12
Start:27952073
stop:27953910
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g25160
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G50530AT Annotation by Michelle Graham. TAIR10: CDPK-related kinase | chr3:18753833-18756487 FORWARD LENGTH=601 SoyBaseE_val: 2.00E-60ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0016926GO-bp Annotation by Michelle Graham. GO Biological Process: protein desumoylation SoyBaseN/AISS
GO:0050665GO-bp Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide biosynthetic process SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0004713GO-mf Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity SoyBaseN/AISS
GO:0004723GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium-dependent protein serine/threonine phosphatase activity SoyBaseN/AISS
GO:0005509GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium ion binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PTHR24349Panther SERINE/THREONINE-PROTEIN KINASE JGI ISS
PTHR24349:SF13Panther JGI ISS
PF00069PFAM Protein kinase domain JGI ISS
UniRef100_G7JMG6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Calcium/calmodulin-dependent protein kinase CaMK3 n=1 Tax=Medicago truncatula RepID=G7JMG6_MEDTR SoyBaseE_val: 3.00E-61ISS
UniRef100_I1JEW5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JEW5_SOYBN SoyBaseE_val: 3.00E-67ISS

Expression Patterns of Glyma12g25160
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g25160 not represented in the dataset
Glyma12g25160 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g25160 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma12g25160
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g25160
>Glyma12g25160.1   sequence type=CDS   gene model=Glyma12g25160   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTATCAGATTTTGTCAGACCAGATGAAAGGCTTAATGATATTGTTGGAAGTGCATACTATGTGGCCCCTGAAGTTCTCCATAGATCTTATGGCACAGAGGTTGATGTGTGGAGTATAGGTGTGATAACATATATTTTATTATGTGGCAGTCGTCCATTTTGGGCCCGAACAAAGTTTGGTATTTTTATGGTAGTTTTGAAAGCTAATCCAAGCTTTGACAAAACACTGTGGCCATCTTTGTCTTTAGAAGCTAAAGATTTTGTCAAACGCATATTGAATAAGGATCCACAGAATCGAATATCTGCTGCTCAGGCTCTAAGTCATCCTTGGATACAAAATTGCAATAATGAACTTGGACTTGGTCCCTCTATCCCTGTTCATGTCGTTCTTCATGATTGGATACGCCATACTGATGGCAAGTTAAGTTTTCTTGGGTTTGTCAAATTTAAAGCAAAAGCCCTATGGATATGCTGA
Predicted protein sequences of Glyma12g25160
>Glyma12g25160.1   sequence type=predicted peptide   gene model=Glyma12g25160   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LSDFVRPDERLNDIVGSAYYVAPEVLHRSYGTEVDVWSIGVITYILLCGSRPFWARTKFGIFMVVLKANPSFDKTLWPSLSLEAKDFVKRILNKDPQNRISAAQALSHPWIQNCNNELGLGPSIPVHVVLHDWIRHTDGKLSFLGFVKFKAKALWIC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo