Glyma12g24931 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g24931): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g24931): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g24931

Feature Type:	gene_model
Chromosome:	Gm12
Start:	27761772
stop:	27762428
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma12g24931

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G13750	AT	Annotation by Michelle Graham. TAIR10: zinc induced facilitator-like 1 \| chr5:4438896-4441289 FORWARD LENGTH=392	SoyBase	E_val: 1.00E-20	ISS
GO:0055085	GO-bp	Annotation by Michelle Graham. GO Biological Process: transmembrane transport	SoyBase	N/A	ISS
GO:0080167	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to karrikin	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0005215	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transporter activity	SoyBase	N/A	ISS
PTHR24003	Panther	MAJOR FACILITATOR SUPERFAMILY DOMAIN-CONTAINING PR	JGI		ISS
PTHR24003:SF14	Panther	SUBFAMILY NOT NAMED	JGI		ISS
UniRef100_G7J342	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Membrane protein, putative n=1 Tax=Medicago truncatula RepID=G7J342_MEDTR	SoyBase	E_val: 3.00E-27	ISS
UniRef100_UPI000233A8F1	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233A8F1 related cluster n=1 Tax=unknown RepID=UPI000233A8F1	SoyBase	E_val: 5.00E-47	ISS

Expression Patterns of Glyma12g24931

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g24931 not represented in the dataset	Glyma12g24931 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g24931 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma12g24931

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma12g24931

Limit To All Plant Sequences

>Glyma12g24931.1   sequence type=CDS   gene model=Glyma12g24931   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTTACCCTATATCGATTGGTGCAAAAAGCTTGTGGACCTGTTGCTCTAGTTCGTATAGAAGGGGTGTTATCCATACTTCTCTTGCAATGCTATCCCCTCATGAAAATGTTATCAGGCTTCACACTGGACATAGTGATCAATATTGCCTCCATTCTGAAGAATGTTTTGATTGAGGCAATTGCTACTAGTTTATTTGTTCTGCAAAATGAAGTTGTGGTGAATCTTTGGGGGACAACTAATAGTATTGCTACGACTGGCATGTCAGCATTCAAAACAATTGGTCCTGCTAGTGCAGGTGCATTGTAA

Predicted protein sequences of Glyma12g24931

Limit To All Plant Sequences

>Glyma12g24931.1   sequence type=predicted peptide   gene model=Glyma12g24931   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LTLYRLVQKACGPVALVRIEGVLSILLLQCYPLMKMLSGFTLDIVINIASILKNVLIEAIATSLFVLQNEVVVNLWGTTNSIATTGMSAFKTIGPASAGAL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain