SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g24860

Feature Type:gene_model
Chromosome:Gm12
Start:27645627
stop:27648694
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g24860
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G15352AT Annotation by Michelle Graham. TAIR10: cytochrome c oxidase 17 | chr3:5180266-5180490 FORWARD LENGTH=74 SoyBaseE_val: 2.00E-30ISS
GO:0006626GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion SoyBaseN/AISS
GO:0006825GO-bp Annotation by Michelle Graham. GO Biological Process: copper ion transport SoyBaseN/AISS
GO:0009617GO-bp Annotation by Michelle Graham. GO Biological Process: response to bacterium SoyBaseN/AISS
GO:0046688GO-bp Annotation by Michelle Graham. GO Biological Process: response to copper ion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0016531GO-mf Annotation by Michelle Graham. GO Molecular Function: copper chaperone activity SoyBaseN/AISS
KOG3496 KOG Cytochrome c oxidase assembly protein/Cu2+ chaperone COX17 JGI ISS
PTHR16719Panther CYTOCHROME C OXIDASE COPPER CHAPERONE JGI ISS
PF05051PFAM Cytochrome C oxidase copper chaperone (COX17) JGI ISS
UniRef100_B9T0E6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome c oxidase copper chaperone, putative n=1 Tax=Ricinus communis RepID=B9T0E6_RICCO SoyBaseE_val: 1.00E-35ISS
UniRef100_I1LT50UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LT50_SOYBN SoyBaseE_val: 7.00E-51ISS

Expression Patterns of Glyma12g24860
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g24860 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g154400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma12g24860
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g24860
>Glyma12g24860.1   sequence type=CDS   gene model=Glyma12g24860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTGGTGCGCAACTGCAAAGTGCTTCCCCTGCCTTGATCATACAAGGGTCACAGAAAAATGAAGGTTCAGTGGCTGTGGCAACTGCTGCAGAGTCAAAGCCAAAGAAGAAAATCTGCTGTGCTTGCCCGGACACTAAAAGGTTGCGAGATGAATGCATAGTAGAGCATGGTGAATCAGCCTGTACAAAGTGGATTGAGGCTCATCGACTGTGCCTCCGTGCTGAGGGATTCAATGTTTGA
Predicted protein sequences of Glyma12g24860
>Glyma12g24860.1   sequence type=predicted peptide   gene model=Glyma12g24860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSGAQLQSASPALIIQGSQKNEGSVAVATAAESKPKKKICCACPDTKRLRDECIVEHGESACTKWIEAHRLCLRAEGFNV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo