SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g24840

Feature Type:gene_model
Chromosome:Gm12
Start:27643379
stop:27645256
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g24840
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G15353AT Annotation by Michelle Graham. TAIR10: metallothionein 3 | chr3:5180825-5181325 REVERSE LENGTH=69 SoyBaseE_val: 5.00E-15ISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0006878GO-bp Annotation by Michelle Graham. GO Biological Process: cellular copper ion homeostasis SoyBaseN/AISS
GO:0006970GO-bp Annotation by Michelle Graham. GO Biological Process: response to osmotic stress SoyBaseN/AISS
GO:0007389GO-bp Annotation by Michelle Graham. GO Biological Process: pattern specification process SoyBaseN/AISS
GO:0008361GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell size SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009750GO-bp Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus SoyBaseN/AISS
GO:0009926GO-bp Annotation by Michelle Graham. GO Biological Process: auxin polar transport SoyBaseN/AISS
GO:0009963GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of flavonoid biosynthetic process SoyBaseN/AISS
GO:0010015GO-bp Annotation by Michelle Graham. GO Biological Process: root morphogenesis SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0040007GO-bp Annotation by Michelle Graham. GO Biological Process: growth SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
UniRef100_I1LT49UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LT49_SOYBN SoyBaseE_val: 7.00E-37ISS
UniRef100_Q84RC4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Metallothionein-like protein n=1 Tax=Arachis hypogaea RepID=Q84RC4_ARAHY SoyBaseE_val: 1.00E-26ISS

Expression Patterns of Glyma12g24840
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g24840 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g154300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma12g24840
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g24840
>Glyma12g24840.1   sequence type=CDS   gene model=Glyma12g24840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGAACACATGCGGCAACTGTGACTGCGCTGACAAGACTAACTGCACCAAGGGAAACAGCTATGGTGTTATAGTAGAGACTGAGAAGAGCTACATCGAGACTGTTGACATGGATGTTCCAGCAGCTGAGCATGATGGGAAGTGCAAGTGTGGCACTAACTGCACTTGCACGGACTGCACTTGTGGCCATTAA
Predicted protein sequences of Glyma12g24840
>Glyma12g24840.1   sequence type=predicted peptide   gene model=Glyma12g24840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSNTCGNCDCADKTNCTKGNSYGVIVETEKSYIETVDMDVPAAEHDGKCKCGTNCTCTDCTCGH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo