|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G19850 | AT | Annotation by Michelle Graham. TAIR10: Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related | chr1:6887353-6891182 FORWARD LENGTH=902 | SoyBase | E_val: 1.00E-34 | ISS |
| GO:0006346 | GO-bp | Annotation by Michelle Graham. GO Biological Process: methylation-dependent chromatin silencing | SoyBase | N/A | ISS |
| GO:0006355 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0007155 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell adhesion | SoyBase | N/A | ISS |
| GO:0009725 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to hormone stimulus | SoyBase | N/A | ISS |
| GO:0009733 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus | SoyBase | N/A | ISS |
| GO:0009741 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to brassinosteroid stimulus | SoyBase | N/A | ISS |
| GO:0009790 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development | SoyBase | N/A | ISS |
| GO:0009855 | GO-bp | Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry | SoyBase | N/A | ISS |
| GO:0009886 | GO-bp | Annotation by Michelle Graham. GO Biological Process: post-embryonic morphogenesis | SoyBase | N/A | ISS |
| GO:0009887 | GO-bp | Annotation by Michelle Graham. GO Biological Process: organ morphogenesis | SoyBase | N/A | ISS |
| GO:0009908 | GO-bp | Annotation by Michelle Graham. GO Biological Process: flower development | SoyBase | N/A | ISS |
| GO:0009909 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of flower development | SoyBase | N/A | ISS |
| GO:0009942 | GO-bp | Annotation by Michelle Graham. GO Biological Process: longitudinal axis specification | SoyBase | N/A | ISS |
| GO:0009944 | GO-bp | Annotation by Michelle Graham. GO Biological Process: polarity specification of adaxial/abaxial axis | SoyBase | N/A | ISS |
| GO:0009965 | GO-bp | Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis | SoyBase | N/A | ISS |
| GO:0010014 | GO-bp | Annotation by Michelle Graham. GO Biological Process: meristem initiation | SoyBase | N/A | ISS |
| GO:0010051 | GO-bp | Annotation by Michelle Graham. GO Biological Process: xylem and phloem pattern formation | SoyBase | N/A | ISS |
| GO:0010073 | GO-bp | Annotation by Michelle Graham. GO Biological Process: meristem maintenance | SoyBase | N/A | ISS |
| GO:0010090 | GO-bp | Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis | SoyBase | N/A | ISS |
| GO:0010305 | GO-bp | Annotation by Michelle Graham. GO Biological Process: leaf vascular tissue pattern formation | SoyBase | N/A | ISS |
| GO:0016246 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA interference | SoyBase | N/A | ISS |
| GO:0031048 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chromatin silencing by small RNA | SoyBase | N/A | ISS |
| GO:0045010 | GO-bp | Annotation by Michelle Graham. GO Biological Process: actin nucleation | SoyBase | N/A | ISS |
| GO:0048364 | GO-bp | Annotation by Michelle Graham. GO Biological Process: root development | SoyBase | N/A | ISS |
| GO:0048439 | GO-bp | Annotation by Michelle Graham. GO Biological Process: flower morphogenesis | SoyBase | N/A | ISS |
| GO:0048481 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ovule development | SoyBase | N/A | ISS |
| GO:0048507 | GO-bp | Annotation by Michelle Graham. GO Biological Process: meristem development | SoyBase | N/A | ISS |
| GO:0048519 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of biological process | SoyBase | N/A | ISS |
| GO:0048527 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lateral root development | SoyBase | N/A | ISS |
| GO:0048765 | GO-bp | Annotation by Michelle Graham. GO Biological Process: root hair cell differentiation | SoyBase | N/A | ISS |
| GO:0051567 | GO-bp | Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation | SoyBase | N/A | ISS |
| GO:0071555 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell wall organization | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0003700 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| GO:0042802 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: identical protein binding | SoyBase | N/A | ISS |
| GO:0044212 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transcription regulatory region DNA binding | SoyBase | N/A | ISS |
| UniRef100_B9R865 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Auxin response factor, putative n=1 Tax=Ricinus communis RepID=B9R865_RICCO | SoyBase | E_val: 3.00E-44 | ISS |
| UniRef100_I1MC56 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MC56_SOYBN | SoyBase | E_val: 9.00E-59 | ISS |
|
Glyma12g24368 not represented in the dataset |
Glyma12g24368 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.12g153700 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma12g24368.1 sequence type=CDS gene model=Glyma12g24368 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGATGGCTTCCATGGAAGAAAAGATTAAAATTGGAGGAGGAATGATTGTTGGTGCTCAAACTCTTGCTGCTGAGATGAAACTGTTGAAAGAAATGCAAGAGCATTCTGGGGTCAGAAAGACTTTGAATTCAGAGTTATGGCATGCTTGTGCAAGGCCTCTTGTGTCATTACCCCAAGTTGGGAGCCTTGTGTTTTACTTCCCTCAGGGACATAGTGAGCAGGTGGAAGCTTCTACTAGAAGAACAACAACGTCACATATTCCAAACTACCCCAATCTTCCATATCAGTTGATGTGTCAAGTTCAAAATGCCATACTTCATGGAGGATAA
>Glyma12g24368.1 sequence type=predicted peptide gene model=Glyma12g24368 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MMASMEEKIKIGGGMIVGAQTLAAEMKLLKEMQEHSGVRKTLNSELWHACARPLVSLPQVGSLVFYFPQGHSEQVEASTRRTTTSHIPNYPNLPYQLMCQVQNAILHGG*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||