SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g24205

Feature Type:gene_model
Chromosome:Gm12
Start:26933992
stop:26934562
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g24205
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G20510AT Annotation by Michelle Graham. TAIR10: alfin-like 5 | chr5:6939991-6942846 REVERSE LENGTH=260 SoyBaseE_val: 5.00E-33ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0035064GO-mf Annotation by Michelle Graham. GO Molecular Function: methylated histone residue binding SoyBaseN/AISS
PTHR23123Panther PHD/F-BOX CONTAINING PROTEIN JGI ISS
PF12165PFAM Domain of unknown function (DUF3594) JGI ISS
UniRef100_B9RQU2UniRef Annotation by Michelle Graham. Most informative UniRef hit: DNA binding protein, putative n=1 Tax=Ricinus communis RepID=B9RQU2_RICCO SoyBaseE_val: 7.00E-37ISS
UniRef100_C6TDZ8UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TDZ8_SOYBN SoyBaseE_val: 1.00E-40ISS

Expression Patterns of Glyma12g24205
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g24205 not represented in the dataset
Glyma12g24205 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g24205 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g153100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma12g24205
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g24205
>Glyma12g24205.1   sequence type=CDS   gene model=Glyma12g24205   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGGAAAAAGACTGGTTATCTTTAGTTGTTGTTCATAGTGATACATGGCTACTTGCCCTTGCCTTTTACTTCGGAGCCAGATTTGGATTTGATAAAACTCACAGGAATAGACTATTCAGTATGATCAATGAACTACCAACAATATTTGAAGTTGTTACTAGTGCAGCAAAGAAACAAGTTAAAGAGAAGTCTTCGGTTTCAAACAACAGTGGCAGCAAATCTAAATCTAGGTCTAACTTGTATGATTTCATTTCTTGTATCTAG
Predicted protein sequences of Glyma12g24205
>Glyma12g24205.1   sequence type=predicted peptide   gene model=Glyma12g24205   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQEKDWLSLVVVHSDTWLLALAFYFGARFGFDKTHRNRLFSMINELPTIFEVVTSAAKKQVKEKSSVSNNSGSKSKSRSNLYDFISCI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo