|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G20320 | AT | Annotation by Michelle Graham. TAIR10: dicer-like 4 | chr5:6859571-6869068 REVERSE LENGTH=1702 | SoyBase | E_val: 3.00E-11 | ISS |
| GO:0000398 | GO-bp | Annotation by Michelle Graham. GO Biological Process: mRNA splicing, via spliceosome | SoyBase | N/A | ISS |
| GO:0006306 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA methylation | SoyBase | N/A | ISS |
| GO:0006342 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chromatin silencing | SoyBase | N/A | ISS |
| GO:0006353 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, termination | SoyBase | N/A | ISS |
| GO:0006355 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0006396 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA processing | SoyBase | N/A | ISS |
| GO:0007267 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell-cell signaling | SoyBase | N/A | ISS |
| GO:0009616 | GO-bp | Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing | SoyBase | N/A | ISS |
| GO:0009640 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photomorphogenesis | SoyBase | N/A | ISS |
| GO:0009793 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy | SoyBase | N/A | ISS |
| GO:0009845 | GO-bp | Annotation by Michelle Graham. GO Biological Process: seed germination | SoyBase | N/A | ISS |
| GO:0009909 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of flower development | SoyBase | N/A | ISS |
| GO:0009933 | GO-bp | Annotation by Michelle Graham. GO Biological Process: meristem structural organization | SoyBase | N/A | ISS |
| GO:0010050 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vegetative phase change | SoyBase | N/A | ISS |
| GO:0010162 | GO-bp | Annotation by Michelle Graham. GO Biological Process: seed dormancy process | SoyBase | N/A | ISS |
| GO:0010182 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0010216 | GO-bp | Annotation by Michelle Graham. GO Biological Process: maintenance of DNA methylation | SoyBase | N/A | ISS |
| GO:0010228 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem | SoyBase | N/A | ISS |
| GO:0010267 | GO-bp | Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference | SoyBase | N/A | ISS |
| GO:0010599 | GO-bp | Annotation by Michelle Graham. GO Biological Process: production of lsiRNA involved in RNA interference | SoyBase | N/A | ISS |
| GO:0016567 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein ubiquitination | SoyBase | N/A | ISS |
| GO:0016569 | GO-bp | Annotation by Michelle Graham. GO Biological Process: covalent chromatin modification | SoyBase | N/A | ISS |
| GO:0019915 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lipid storage | SoyBase | N/A | ISS |
| GO:0022402 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell cycle process | SoyBase | N/A | ISS |
| GO:0030422 | GO-bp | Annotation by Michelle Graham. GO Biological Process: production of siRNA involved in RNA interference | SoyBase | N/A | ISS |
| GO:0031047 | GO-bp | Annotation by Michelle Graham. GO Biological Process: gene silencing by RNA | SoyBase | N/A | ISS |
| GO:0035196 | GO-bp | Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA | SoyBase | N/A | ISS |
| GO:0043687 | GO-bp | Annotation by Michelle Graham. GO Biological Process: post-translational protein modification | SoyBase | N/A | ISS |
| GO:0045893 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0050826 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to freezing | SoyBase | N/A | ISS |
| GO:0051607 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to virus | SoyBase | N/A | ISS |
| GO:0005622 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: intracellular | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0003676 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding | SoyBase | N/A | ISS |
| GO:0003677 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA binding | SoyBase | N/A | ISS |
| GO:0003723 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: RNA binding | SoyBase | N/A | ISS |
| GO:0003725 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: double-stranded RNA binding | SoyBase | N/A | ISS |
| GO:0004386 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: helicase activity | SoyBase | N/A | ISS |
| GO:0004525 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ribonuclease III activity | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| GO:0008026 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP-dependent helicase activity | SoyBase | N/A | ISS |
| GO:0016787 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydrolase activity | SoyBase | N/A | ISS |
| GO:0016891 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: endoribonuclease activity, producing 5'-phosphomonoesters | SoyBase | N/A | ISS |
| UniRef100_B9HAP9 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Dicer-like protein n=1 Tax=Populus trichocarpa RepID=B9HAP9_POPTR | SoyBase | E_val: 2.00E-20 | ISS |
| UniRef100_I1LZM8 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LZM8_SOYBN | SoyBase | E_val: 7.00E-35 | ISS |
|
Glyma12g24163 not represented in the dataset |
Glyma12g24163 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.12g152800 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma12g24163.1 sequence type=CDS gene model=Glyma12g24163 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCATGATAATGTGATTTTCGGTCTGCAGAATCTTGGCATTTGGGGAGCATTGCAAGCTAGTCATATTCTTCTGAGTGGTGATCATTCTGAGAGGCATGAATTATTGGAGGCAGATGGAAATTCAAGTGATGAGTCTCTGTGTGATAAATATCTTGCTCAGGCTGCTGAACTATTTACTTCACAATGCATGACAGGGAGTGAGCGTGCATCTCAGGCATTATCAGCTGGGTCCCCTTCTTTCTTAGCCTATGGTGTCTACCCTATTTATTCAGCTTCTTGGAACTATTATTACATATTTATTAGTTATAAATGTCTTGTATTTAATTAG
>Glyma12g24163.1 sequence type=predicted peptide gene model=Glyma12g24163 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MHDNVIFGLQNLGIWGALQASHILLSGDHSERHELLEADGNSSDESLCDKYLAQAAELFTSQCMTGSERASQALSAGSPSFLAYGVYPIYSASWNYYYIFISYKCLVFN*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||