SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g23920): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g23920): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g23920

Feature Type:gene_model
Chromosome:Gm12
Start:26614248
stop:26617494
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G24220AT Annotation by Michelle Graham. TAIR10: purine permease 5 | chr2:10300603-10301688 FORWARD LENGTH=361 SoyBaseE_val: 9.00E-149ISS
GO:0006863GO-bp Annotation by Michelle Graham. GO Biological Process: purine nucleobase transport SoyBaseN/AISS
GO:0015931GO-bp Annotation by Michelle Graham. GO Biological Process: nucleobase-containing compound transport SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005345GO-mf Annotation by Michelle Graham. GO Molecular Function: purine nucleobase transmembrane transporter activity SoyBaseN/AISS
KOG1443 KOG Predicted integral membrane protein JGI ISS
PF00892PFAM EamA-like transporter family JGI ISS
PF03151PFAM Triose-phosphate Transporter family JGI ISS
UniRef100_B9STQ6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Purine transporter, putative n=1 Tax=Ricinus communis RepID=B9STQ6_RICCO SoyBaseE_val: 5.00E-168ISS
UniRef100_I1LT42UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LT42_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g23920 not represented in the dataset

Glyma12g23920 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g152500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma12g23920.1   sequence type=CDS   gene model=Glyma12g23920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACATCTCTGCCACTTATTCAACCTGAAAGTATGGAGGCAGAACCATCGATTCCCTCAGATTCACTCCGGGCCCAGATTTCCAAATTTTCTACCATGCTCACTGAAGCACACAAAAGAAAGCCAATCCATTATTGGATTCTTCTTGTTCTCAGCATCTTGGCAATGCTTGTGGCATTTCCTGCTTCCAGCATTCTGTCTCGTGTTTATTATGATAACGGTGGCCAGAGTAAGTGGATCATATCTTGGGTAGCAGTTGCTGGATGGCCCCTAACTGCCTTAATACTGTTTCCTGTATACTTTATCAGTAAAACCTTTCCTACTCCTCTGAACTTAAAACTGAGTCTGTCTTATATCGTTTTGGGTTTCCTAAGTGCTGCTGATAACCTCATGTATGCTTATGCCTATGCTTACCTCCCTGCATCCACTGCCTCACTTGTGGCATCATCATCCCTTGTGTTTTCGGCGCTCTTTGGATACTTTCTTGTGAAGAACAAAGTGAATGCTTCAATAGTGAATTCCGTTTTCGTCATAACCGCTGCATTGACCATCATTGCCCTGGACTCGAGTTCAGACAGATATCCCAGCATTAGTGACAGTGAATACATCATGGGATTTGTATGGGATGTTTTAGGATCTGCTTTCCATGGGCTTATTTTCGCTCTCTCAGAGCTCGTCTTTGTGAAGTTGCTCGGAAGAAGATCCTTTATCGTTGTTCTGGAGCAGCAAGTCATGGTTTCTCTATTTGCATTTCTGTTTACCACTGTAGGGATGATTGTGAGTGGTGATTTTCAAGGGATGGCACATGAGGCTACCACTTTCGAAGGTGGTAGAAGTGCTTATTATCTTGTTATCATTTGGGGTGCAATCACTTTTCAGCTGGGGGTTCTGGGGGGCACTGCTATAATTTTCTTGGGCTCTACTGTGCTAGCAGGTGTGCTTAATGCAGTAAGAACACCCATAACAAGCATTGCAGCTGTTATACTGCTAAAGGACCCTATGAGTGGTTTCAAGATCCTCTCCCTAGTGATCACCTTTTGGGGATTTGGCTCATATATTTATGGCAGTTCTATGGGTGAAAAATCATCATAA

>Glyma12g23920.1   sequence type=predicted peptide   gene model=Glyma12g23920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTSLPLIQPESMEAEPSIPSDSLRAQISKFSTMLTEAHKRKPIHYWILLVLSILAMLVAFPASSILSRVYYDNGGQSKWIISWVAVAGWPLTALILFPVYFISKTFPTPLNLKLSLSYIVLGFLSAADNLMYAYAYAYLPASTASLVASSSLVFSALFGYFLVKNKVNASIVNSVFVITAALTIIALDSSSDRYPSISDSEYIMGFVWDVLGSAFHGLIFALSELVFVKLLGRRSFIVVLEQQVMVSLFAFLFTTVGMIVSGDFQGMAHEATTFEGGRSAYYLVIIWGAITFQLGVLGGTAIIFLGSTVLAGVLNAVRTPITSIAAVILLKDPMSGFKILSLVITFWGFGSYIYGSSMGEKSS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo