SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g22371

Feature Type:gene_model
Chromosome:Gm12
Start:24353336
stop:24356187
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g22371
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G13677AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; Has 24 Blast hits to 24 proteins in 11 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 24; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr3:4476296-4476611 FORWARD LENGTH=76 SoyBaseE_val: 1.00E-20ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_C6TM00UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TM00_SOYBN SoyBaseE_val: 1.00E-48ISS
UniRef100_Q75ID7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Oryza sativa Japonica Group RepID=Q75ID7_ORYSJ SoyBaseE_val: 2.00E-16ISS

Expression Patterns of Glyma12g22371
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g22371 not represented in the dataset
Glyma12g22371 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma12g22371
ParalogEvidenceComments
Glyma06g39656 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma12g22371 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g147500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma12g22371
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g22371
>Glyma12g22371.1   sequence type=CDS   gene model=Glyma12g22371   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGGAGACTGGAGATATTAGTCAGCCTGAACCACCGAAACAGGTGTGGTGTGAGGAAAAACAGGCTTCTGTTCATGAAGAAATTAAGAGAATGAACCAATTGCCTGCAAACAGTTCATATGTTACACATCGTCTGAAGGTTCTTAATAAAATTTTGCAACTCATGTCAGTTCAGAGAACTGTATCCCGAGAGCAGGAGTTGGAGTTGCTTTTTGCTGGGCTTTCTTTGTGA
Predicted protein sequences of Glyma12g22371
>Glyma12g22371.1   sequence type=predicted peptide   gene model=Glyma12g22371   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMETGDISQPEPPKQVWCEEKQASVHEEIKRMNQLPANSSYVTHRLKVLNKILQLMSVQRTVSREQELELLFAGLSL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo