Glyma12g21920 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g21920): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g21920): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g21920

Feature Type:	gene_model
Chromosome:	Gm12
Start:	23703134
stop:	23704169
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma12g21920

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G27280	AT	Annotation by Michelle Graham. TAIR10: Calcium-binding EF-hand family protein \| chr4:13663770-13664162 REVERSE LENGTH=130	SoyBase	E_val: 9.00E-30	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0009612	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to mechanical stimulus	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0080167	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to karrikin	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0005509	GO-mf	Annotation by Michelle Graham. GO Molecular Function: calcium ion binding	SoyBase	N/A	ISS
PTHR10891	Panther	CALMODULIN	JGI		ISS
PTHR10891:SF148	Panther	CALCIUM-BINDING EF HAND FAMILY PROTEIN	JGI		ISS
UniRef100_I1KE59	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KE59_SOYBN	SoyBase	E_val: 7.00E-68	ISS
UniRef100_Q2HVQ3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Calcium-binding EF-hand n=1 Tax=Medicago truncatula RepID=Q2HVQ3_MEDTR	SoyBase	E_val: 2.00E-47	ISS

Expression Patterns of Glyma12g21920

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g21920 not represented in the dataset	Glyma12g21920 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g21920 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.12g145900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma12g21920

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma12g21920

Limit To All Plant Sequences

>Glyma12g21920.2   sequence type=CDS   gene model=Glyma12g21920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGCTAGATTATGGTTTTGACTTTGAGGACTGCTTCCCTTCGATGATTGCGCGGTTGGGCGCGGAAGGGTTCATCGGGGAGCTTTGCAACGGGTTCCGGTTGCTCATGGATGTGAACATGGGGCTCATAACATTTGAGAGCTTGAAGATGAGCACTAACTTGCTTGGTTTGGAGGTGAGGGATGATGAGTTGTTGTGCATGCTTATGGAAGGTGATTTGGATGGAGATGGGGCTCTTAACCAGATGGAGTTTTGCATTCTCATGTTTAGGTTGAGTCCGTGCTTGATGGATATGCAAGGTATGGAACCGGTCCATCATGTTAATGTCATATAG

Predicted protein sequences of Glyma12g21920

Limit To All Plant Sequences

>Glyma12g21920.2   sequence type=predicted peptide   gene model=Glyma12g21920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MELDYGFDFEDCFPSMIARLGAEGFIGELCNGFRLLMDVNMGLITFESLKMSTNLLGLEVRDDELLCMLMEGDLDGDGALNQMEFCILMFRLSPCLMDMQGMEPVHHVNVI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain