SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g20160): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g20160): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g20160

Feature Type:gene_model
Chromosome:Gm12
Start:21191790
stop:21194775
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G53230AT Annotation by Michelle Graham. TAIR10: TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 3 | chr1:19850260-19851435 REVERSE LENGTH=391 SoyBaseE_val: 1.00E-100ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0009617GO-bp Annotation by Michelle Graham. GO Biological Process: response to bacterium SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0016226GO-bp Annotation by Michelle Graham. GO Biological Process: iron-sulfur cluster assembly SoyBaseN/AISS
GO:0030154GO-bp Annotation by Michelle Graham. GO Biological Process: cell differentiation SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0045962GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of development, heterochronic SoyBaseN/AISS
GO:0048366GO-bp Annotation by Michelle Graham. GO Biological Process: leaf development SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF03634PFAM TCP family transcription factor JGI ISS
UniRef100_Q8RW43UniRef Annotation by Michelle Graham. Most informative UniRef hit: TCP1 protein n=1 Tax=Lupinus albus RepID=Q8RW43_LUPAL SoyBaseE_val: 6.00E-131ISS
UniRef100_UPI000233CE93UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233CE93 related cluster n=1 Tax=unknown RepID=UPI000233CE93 SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g20160 not represented in the dataset

Glyma12g20160 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g158900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma12g20160.2   sequence type=CDS   gene model=Glyma12g20160   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAGAACCACAACACCCTCACCAGCACCATCAACAAGCAGCAGCAACACCGTCGAGAGCGGCGATGAGAGGCGGCGGCGGCGGCGAGATTGTGGAGGTGCAAGGCGGCCACATTGTCCGCTCCACCGGACGGAAGGACCGCCACAGCAAGGTCTGCACTGCCAAAGGCCCCCGAGACCGCCGCGTGCGCCTGGCGGCGCACACCGCCATCCAGTTCTACGACGTCCAGGACCGCCTTGGCTACGACCGTCCCAGCAAGGCGGTCGACTGGCTCATCAAGAAAGCCAAGGCAGCCATCGACCAACTCGCGGAGCTCCCGCCATGGAACCCCACCGCCACGCCAATGCAACCGCCTTCCCAAGAAATTGTCCACCGCGAAAACAAATCTCTCGGGATGGACGATTCATTGACAGCCTTCAGTTGCCGCGGCGAGAGCCCCGCTTTCGCCGCGGCTACTAGAGATTCAGAACAATTCTCTCACCCACAAGTAGAGCAGAATGAAAATGCTAACAACATCAGCAGCAGCAGCATCAGCATCAAATACAATAGCGGTTCTGGTTTTCTGCCGGCGTCCTTGGACACTGACAATATTGCGGAGACAATCAAGACTTTCTTTCCAGTGGAGGCGACTACGACGTCGTTTCAGAGTTACCCGCCGGCGCCACCGGATTTGGGGCAGCAAGATCTACGGCTCTCGCTACAGTCCTTTCAGGACCCTATTATGCTTCATCACCAGCCTCAGAGTCACCACGAGCCGGTGCTCTTTGCCGGAACCGCCGCCGCGGCGCTCGGCTTCGACGGCGGTTACGGGTGGTCAGAACACCAGCACCAGAACCATCACTCGGAGGAACAGCGATTGCTCTATGCTGGTGGCAACAGTGGCCATGGCGGTGGGTTTGTGTTCAACACGCCGGCGCCGGTGCCGGCGTTTGGCCAGTTTTTTTCTCAGAGGGGACCCCTTCAGTCCAGTAACACCCCTTCGATTCGTGCTTGGATAGACCCTTCGGTCGATCACCACCACCATCATCATCACTACCTCTCGCAGTTGATCCACCAGGGTTCCGTCGCCGGAGGCAGCGGATTCTCCAGTGGATTCTCCGGCTTCCGCATTCCAGCACGAATTCAGGGTGAAGAGGAACACGACGGCGTATCGGACAAGCCGTCCTCTGCTTCCTCTGATTCTCGCCATTGA

>Glyma12g20160.2   sequence type=predicted peptide   gene model=Glyma12g20160   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGEPQHPHQHHQQAAATPSRAAMRGGGGGEIVEVQGGHIVRSTGRKDRHSKVCTAKGPRDRRVRLAAHTAIQFYDVQDRLGYDRPSKAVDWLIKKAKAAIDQLAELPPWNPTATPMQPPSQEIVHRENKSLGMDDSLTAFSCRGESPAFAAATRDSEQFSHPQVEQNENANNISSSSISIKYNSGSGFLPASLDTDNIAETIKTFFPVEATTTSFQSYPPAPPDLGQQDLRLSLQSFQDPIMLHHQPQSHHEPVLFAGTAAAALGFDGGYGWSEHQHQNHHSEEQRLLYAGGNSGHGGGFVFNTPAPVPAFGQFFSQRGPLQSSNTPSIRAWIDPSVDHHHHHHHYLSQLIHQGSVAGGSGFSSGFSGFRIPARIQGEEEHDGVSDKPSSASSDSRH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo