|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT2G26260 | AT | Annotation by Michelle Graham. TAIR10: 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 2 | chr2:11178586-11182872 FORWARD LENGTH=473 | SoyBase | E_val: 7.00E-44 | ISS |
GO:0006694 | GO-bp | Annotation by Michelle Graham. GO Biological Process: steroid biosynthetic process | SoyBase | N/A | ISS |
GO:0016126 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process | SoyBase | N/A | ISS |
GO:0019745 | GO-bp | Annotation by Michelle Graham. GO Biological Process: pentacyclic triterpenoid biosynthetic process | SoyBase | N/A | ISS |
GO:0055114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process | SoyBase | N/A | ISS |
GO:0005783 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum | SoyBase | N/A | ISS |
GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
GO:0003854 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: 3-beta-hydroxy-delta5-steroid dehydrogenase activity | SoyBase | N/A | ISS |
GO:0016616 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor | SoyBase | N/A | ISS |
GO:0047012 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sterol-4-alpha-carboxylate 3-dehydrogenase (decarboxylating) activity | SoyBase | N/A | ISS |
UniRef100_G7J951 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform n=1 Tax=Medicago truncatula RepID=G7J951_MEDTR | SoyBase | E_val: 7.00E-46 | ISS |
UniRef100_I1K8I6 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1K8I6_SOYBN | SoyBase | E_val: 4.00E-57 | ISS |
Glyma12g19800 not represented in the dataset |
Glyma12g19800 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.12g159100 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma12g19800.1 sequence type=CDS gene model=Glyma12g19800 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGAGCCTATGAAATTCTGGGAGTTCGTGTCATTGGTAGTGGAAGGTCTTGGATATGAAAGGTCAAGGATAAAGATCCCCACCTTTGTTATCATGCCCATTGCACATTTGGTGGAGTGGATATATAAGCTGCTAGGCCCATATGGGATGAAGCTGCCTCAGCTAATTCCTTCAAGAATAAGAATCATATCTTGCAGCAGAACTTTTGATTGCTCAAAAGCAAAGGATCGCCTTGGCTATGCACCCATTGTAACACTACAGGTTCTATGA
>Glyma12g19800.1 sequence type=predicted peptide gene model=Glyma12g19800 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MEPMKFWEFVSLVVEGLGYERSRIKIPTFVIMPIAHLVEWIYKLLGPYGMKLPQLIPSRIRIISCSRTFDCSKAKDRLGYAPIVTLQVL*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||