SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g19520

Feature Type:gene_model
Chromosome:Gm12
Start:20305737
stop:20309749
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g19520
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G53240AT Annotation by Michelle Graham. TAIR10: Lactate/malate dehydrogenase family protein | chr1:19854966-19856802 REVERSE LENGTH=341 SoyBaseE_val: 0ISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006108GO-bp Annotation by Michelle Graham. GO Biological Process: malate metabolic process SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0006972GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic response SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0009266GO-bp Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0018119GO-bp Annotation by Michelle Graham. GO Biological Process: peptidyl-cysteine S-nitrosylation SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0044262GO-bp Annotation by Michelle Graham. GO Biological Process: cellular carbohydrate metabolic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016615GO-mf Annotation by Michelle Graham. GO Molecular Function: malate dehydrogenase activity SoyBaseN/AISS
GO:0016616GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor SoyBaseN/AISS
GO:0030060GO-mf Annotation by Michelle Graham. GO Molecular Function: L-malate dehydrogenase activity SoyBaseN/AISS
KOG1494 KOG NAD-dependent malate dehydrogenase JGI ISS
PTHR11540Panther MALATE AND LACTATE DEHYDROGENASE JGI ISS
PTHR11540:SF1Panther MALATE DEHYDROGENASE JGI ISS
PF00056PFAM lactate/malate dehydrogenase, NAD binding domain JGI ISS
PF02866PFAM lactate/malate dehydrogenase, alpha/beta C-terminal domain JGI ISS
UniRef100_Q9SPB8UniRef Annotation by Michelle Graham. Best UniRef hit: Malate dehydrogenase n=1 Tax=Glycine max RepID=Q9SPB8_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q9SPB8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Malate dehydrogenase n=1 Tax=Glycine max RepID=Q9SPB8_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma12g19520
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g19520 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g159300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma12g19520
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g19520
>Glyma12g19520.1   sequence type=CDS   gene model=Glyma12g19520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGAAGCCATCGATGCTCAGATCTCTCCACTCCGCCGCCACCCGCGGCGCCTCTCATCTCTTCCGCCGTGGGTACGCCTCCGAGCCGGTGCCGGAGCGCAAGGTAGCCGTTCTCGGCGCCGCCGGCGGGATCGGGCAGCCTCTCTCCCTTCTCATGAAGCTCAATCCCCTCGTTTCGAGCCTCTCCCTTTACGATATCGCCGGAACTCCCGGCGTCGCCGCCGATATCAGCCACATAAACACCAGATCTGAGGTAGTGGGGTACCAAGGTGATGAAGAGCTTGGAAAAGCTTTGGAGGGTGCCGATGTTGTTATAATTCCTGCTGGTGTGCCCAGAAAGCCTGGAATGACTCGTGATGATCTTTTTAACATCAATGCTGGCATTGTTAAGACGCTGTGTACTGCTATTGCTAAGTATTGCCCCCATGCCCTTGTTAACATGATAAGCAATCCTGTGAACTCCACTGTTCCTATTGCTGCTGAAGTTTTCAAGAAGGCAGGAACTTATGATGAGAAGAGATTGTTTGGTGTTACCACCCTTGATGTTGTTAGGGCAAAAACTTTCTATGCTGGGAAAGCCAATGTTCCAGTTGCTGGTGTTAATGTACCTGTTGTGGGCGGCCATGCAGGCATTACTATTCTGCCACTATTTTCTCAAGCCACACCAAAAGCCAATCTTGATGATGATGTCATTAAGGCTCTTACAAAGAGGACACAAGATGGAGGAACAGAAGTTGTAGAAGCTAAGGCTGGAAAGGGTTCTGCAACTTTGTCAATGGCCTATGCTGGTGCCCTTTTTGCTGATGCTTGCCTCAAGGGCCTCAATGGAGTCCCAGATGTTGTCGAGTGCTCTTTCGTGCAATCCACTGTTACTGAACTTCCCTTCTTTGCTTCCAAGGTGAGGCTTGGGACGGTTGGTGTGGAGGAAGTTCTGGGCTTGGGGCACCTCTCAGATTTTGAGCAACAAGGCCTCGAAAGCCTTAAGCCTGAACTCAAATCATCAATTGAGAAGGGAATCAAATTTGCCAACCAGTAA
Predicted protein sequences of Glyma12g19520
>Glyma12g19520.1   sequence type=predicted peptide   gene model=Glyma12g19520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMKPSMLRSLHSAATRGASHLFRRGYASEPVPERKVAVLGAAGGIGQPLSLLMKLNPLVSSLSLYDIAGTPGVAADISHINTRSEVVGYQGDEELGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKTLCTAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKANVPVAGVNVPVVGGHAGITILPLFSQATPKANLDDDVIKALTKRTQDGGTEVVEAKAGKGSATLSMAYAGALFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGTVGVEEVLGLGHLSDFEQQGLESLKPELKSSIEKGIKFANQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo