SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g18983

Feature Type:gene_model
Chromosome:Gm12
Start:19704458
stop:19705173
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g18983
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G27190AT Annotation by Michelle Graham. TAIR10: uridine kinase-like 2 | chr3:10039504-10042917 REVERSE LENGTH=483 SoyBaseE_val: 2.00E-51ISS
GO:0000041GO-bp Annotation by Michelle Graham. GO Biological Process: transition metal ion transport SoyBaseN/AISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006207GO-bp Annotation by Michelle Graham. GO Biological Process: 'de novo' pyrimidine nucleobase biosynthetic process SoyBaseN/AISS
GO:0007010GO-bp Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization SoyBaseN/AISS
GO:0009058GO-bp Annotation by Michelle Graham. GO Biological Process: biosynthetic process SoyBaseN/AISS
GO:0010498GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process SoyBaseN/AISS
GO:0016310GO-bp Annotation by Michelle Graham. GO Biological Process: phosphorylation SoyBaseN/AISS
GO:0044206GO-bp Annotation by Michelle Graham. GO Biological Process: UMP salvage SoyBaseN/AISS
GO:1901141GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of lignin biosynthetic process SoyBaseN/AISS
GO:2000904GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of starch metabolic process SoyBaseN/AISS
GO:2001006GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cellulose biosynthetic process SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0004845GO-mf Annotation by Michelle Graham. GO Molecular Function: uracil phosphoribosyltransferase activity SoyBaseN/AISS
GO:0004849GO-mf Annotation by Michelle Graham. GO Molecular Function: uridine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
PTHR10285Panther URIDINE KINASE RELATED JGI ISS
PTHR10285:SF6Panther URIDINE CYTIDINE KINASE I JGI ISS
PF00485PFAM Phosphoribulokinase / Uridine kinase family JGI ISS
UniRef100_I1MLJ3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Uridine kinase n=2 Tax=Glycine max RepID=I1MLJ3_SOYBN SoyBaseE_val: 1.00E-80ISS
UniRef100_UPI000233D321UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D321 related cluster n=1 Tax=unknown RepID=UPI000233D321 SoyBaseE_val: 1.00E-105ISS

Expression Patterns of Glyma12g18983
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g18983 not represented in the dataset
Glyma12g18983 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g18983 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g160200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma12g18983
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g18983
>Glyma12g18983.1   sequence type=CDS   gene model=Glyma12g18983   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTGAAAGAAACGACGTCGATTGACTACGTAATGGAGGCTGCATCTAGGCCCCACTTCTCCACCCTGAGACTCGACGGTCGAGTCCTATCCTCCGCCACCGTCGCGTCCTCCACTCTCGATTCAAGCCTAACCCTCAATTCCCTTCCCAATCAACCCATTATCATAAGAGTTTCTGGAGGTACTGCCTTGGACAAAACCACCGTCTGCGATATGATCATTCAACAACTCCACGATCATTGCGTTGTCCTTGTAAATCAGGACTTGTTTTATCGCGGGTTGAATCCTGAAGAGTTGGAATGTGCTCACGAGTACAATTTCGACCACCCTGATGCTTTTGACTCGAAGCAATTGTTAGAGTGCACGAGGAAGCTCATTAGTGGTCAAGGCGTGCATGTTCCTATATATGACTTCAAGAATCACCAAGGCTCTTCTGATAATTTTCGCTAG
Predicted protein sequences of Glyma12g18983
>Glyma12g18983.1   sequence type=predicted peptide   gene model=Glyma12g18983   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLKETTSIDYVMEAASRPHFSTLRLDGRVLSSATVASSTLDSSLTLNSLPNQPIIIRVSGGTALDKTTVCDMIIQQLHDHCVVLVNQDLFYRGLNPEELECAHEYNFDHPDAFDSKQLLECTRKLISGQGVHVPIYDFKNHQGSSDNFR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo