SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g18720): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g18720): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g18720

Feature Type:gene_model
Chromosome:Gm12
Start:19480082
stop:19481061
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g18720
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G53980AT Annotation by Michelle Graham. TAIR10: homeobox protein 52 | chr5:21914087-21914557 FORWARD LENGTH=156 SoyBaseE_val: 4.00E-34ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009637GO-bp Annotation by Michelle Graham. GO Biological Process: response to blue light SoyBaseN/AISS
GO:0009646GO-bp Annotation by Michelle Graham. GO Biological Process: response to absence of light SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
PTHR24326Panther FAMILY NOT NAMED JGI ISS
PTHR24326:SF218Panther JGI ISS
PF00046PFAM Homeobox domain JGI ISS
UniRef100_I1LSU6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LSU6_SOYBN SoyBaseE_val: 2.00E-130ISS
UniRef100_Q9FN29UniRef Annotation by Michelle Graham. Most informative UniRef hit: Homeobox-leucine zipper protein ATHB-52 n=1 Tax=Arabidopsis thaliana RepID=ATB52_ARATH SoyBaseE_val: 2.00E-31ISS

Expression Patterns of Glyma12g18720
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g18720 not represented in the dataset
Glyma12g18720 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g18720 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g158400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma12g18720
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g18720
>Glyma12g18720.1   sequence type=CDS   gene model=Glyma12g18720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGGATTTCATCTTCTCCTTCAAGACCCAACCACAAGACCATGCTCACCACCAAAGAGCAAAGCACAACAACAACAACAACAAGAGGCTAACCGAGGACCAGGTCGCGATTCTCGAGAAGTGCTTCGCCTCCAACATGAAGCTCGAGCCGGAGCAGAAGTTCCACCTTGCAAACCAACTTGGTGTGCCTCCAAGACAAGTTGCAATTTGGTATCAAAACAAAAGGGCACGCTGGAAGACCCAGAGCCTCGAGGTGGACCATGGTGTGCTTCAGGCAAGGCTAGAGAATGTAGTGGCTGAAAAGAAGCAGCTAGAGAAAGATGTTGAAAGGCTCAAAGCTGAGCTGAAGAAGGCTCAAGAGATGTTGTTAATCAGCAATAATGTCAAAAGTGGAGACCATAGTAACAATAATAATAATAATGCTTCTTGTGAATTTTCAACTTCTTTTGAAGAAGGAGGGAGTTCTGGGGTGGTGCTTGATGATGCCACTCATCATCATCATCATGAGTGTTGGCAAAGTGGTAGTGAGGTTATGCAGGTTGAGGAGCTCTTTACTTACTTCATGGGTGCAAATTATGGGTCAGGCTTGCATGAGAAAAGGGCATAA
Predicted protein sequences of Glyma12g18720
>Glyma12g18720.1   sequence type=predicted peptide   gene model=Glyma12g18720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGDFIFSFKTQPQDHAHHQRAKHNNNNNKRLTEDQVAILEKCFASNMKLEPEQKFHLANQLGVPPRQVAIWYQNKRARWKTQSLEVDHGVLQARLENVVAEKKQLEKDVERLKAELKKAQEMLLISNNVKSGDHSNNNNNNASCEFSTSFEEGGSSGVVLDDATHHHHHECWQSGSEVMQVEELFTYFMGANYGSGLHEKRA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo