Report for Sequence Feature Glyma12g18710
Feature Type: gene_model
Chromosome: Gm12
Start: 19421359
stop: 19422163
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma12g18710
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G62840 AT
Annotation by Michelle Graham. TAIR10: Small nuclear ribonucleoprotein family protein | chr3:23235727-23236615 REVERSE LENGTH=108
SoyBase E_val: 1.00E-46 ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005732 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: small nucleolar ribonucleoprotein complex
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
KOG3459
KOG
Small nuclear ribonucleoprotein (snRNP) Sm core protein
JGI ISS
PTHR12777 Panther
SMALL NUCLEAR RIBONUCLEOPROTEIN SM D2
JGI ISS
PF01423 PFAM
LSM domain
JGI ISS
UniRef100_B9SNF9 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Small nuclear ribonucleoprotein sm d2, putative n=1 Tax=Ricinus communis RepID=B9SNF9_RICCO
SoyBase E_val: 9.00E-46 ISS
UniRef100_C6T6A5 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T6A5_SOYBN
SoyBase E_val: 8.00E-46 ISS
Expression Patterns of Glyma12g18710
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma12g18710 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.12g158300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma12g18710
Transcripts of Glyma12g18710
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma12g18710.2 sequence type=transcript gene model=Glyma12g18710 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAGGAAGATAATGAGGAAGAGGAGTTCAACACCGAACCGCTATTTGTACTCATGATGAGTGTTAAAAATAATACTCAGGTACTGATAAATTGTCAGAACAACAAAAAGCTTCTGGGTCGTGTAAGGGCTTTTGACAGGAACTGCAACATGGTTCTTGAAAATGTCAGGGAGATATGGACTGAGCCAGTCAACAAGGATAGATTCATCAGCAAAATGTTTCTCCGTGGAGATTCTGTCACCATTGTTCTTAGGAACCCCAAATGA
Coding sequences of Glyma12g18710
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma12g18710.1 sequence type=CDS gene model=Glyma12g18710 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAGGAAGATAATGAGGAAGAGGAGTTCAACACCGAACCGCTATTTGTACTCATGATGAGTGTTAAAAATAATACTCAGGTACTGATAAATTGTCAGAACAACAAAAAGCTTCTGGGTCGTGTAAGGGCTTTTGACAGGAACTGCAACATGGTTCTTGAAAATGTCAGGGAGATATGGACTGAGGTGCCAAAGACTGGTAAAGGAAAGAAAAACGCCTAG
>Glyma12g18710.2 sequence type=CDS gene model=Glyma12g18710 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAGGAAGATAATGAGGAAGAGGAGTTCAACACCGAACCGCTATTTGTACTCATGATGAGTGTTAAAAATAATACTCAGGTACTGATAAATTGTCAGAACAACAAAAAGCTTCTGGGTCGTGTAAGGGCTTTTGACAGGAACTGCAACATGGTTCTTGAAAATGTCAGGGAGATATGGACTGAGCCAGTCAACAAGGATAGATTCATCAGCAAAATGTTTCTCCGTGGAGATTCTGTCACCATTGTTCTTAGGAACCCCAAATGA
Predicted protein sequences of Glyma12g18710
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma12g18710.1 sequence type=predicted peptide gene model=Glyma12g18710 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MEEDNEEEEFNTEPLFVLMMSVKNNTQVLINCQNNKKLLGRVRAFDRNCNMVLENVREIWTEVPKTGKGKKNA*
>Glyma12g18710.2 sequence type=predicted peptide gene model=Glyma12g18710 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MEEDNEEEEFNTEPLFVLMMSVKNNTQVLINCQNNKKLLGRVRAFDRNCNMVLENVREIWTEPVNKDRFISKMFLRGDSVTIVLRNPK*