SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g18162

Feature Type:gene_model
Chromosome:Gm12
Start:18803111
stop:18803638
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g18162
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G53570AT Annotation by Michelle Graham. TAIR10: mitogen-activated protein kinase kinase kinase 3 | chr1:19987391-19990733 FORWARD LENGTH=608 SoyBaseE_val: 7.00E-36ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0006487GO-bp Annotation by Michelle Graham. GO Biological Process: protein N-linked glycosylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004713GO-mf Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PTHR24361Panther MITOGEN-ACTIVATED KINASE KINASE KINASE JGI ISS
PTHR24361:SF64Panther JGI ISS
PF00069PFAM Protein kinase domain JGI ISS
UniRef100_G7JBK2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Mitogen-activated protein kinase kinase kinase n=1 Tax=Medicago truncatula RepID=G7JBK2_MEDTR SoyBaseE_val: 2.00E-40ISS
UniRef100_I1JY21UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JY21_SOYBN SoyBaseE_val: 1.00E-42ISS

Expression Patterns of Glyma12g18162
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g18162 not represented in the dataset
Glyma12g18162 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g18162 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g157300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma12g18162
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g18162
>Glyma12g18162.1   sequence type=CDS   gene model=Glyma12g18162   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTTTTTTGAAACAGATAAATTCTTCTTCCTCCATGCTTTCTTTCAAAGGGAGTCCATACTGGATGGCACCCGAGGTTGTAATGAATACAAATGGCTATAGTCTTCCTGTTGATATATGGAGTTTGGGATGCACAATTCTTGAAATGGCAACATCAAAGCCTCCTTCGAATCAGTATGAAGGGGTAGCTGCAATATTTAAAATTGGTAACAGCAGAGATATGCCTGAAATTCCTGAGATATGCCTGTAA
Predicted protein sequences of Glyma12g18162
>Glyma12g18162.1   sequence type=predicted peptide   gene model=Glyma12g18162   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIFLKQINSSSSMLSFKGSPYWMAPEVVMNTNGYSLPVDIWSLGCTILEMATSKPPSNQYEGVAAIFKIGNSRDMPEIPEICL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo