SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma12g18027

Feature Type:gene_model
Chromosome:Gm12
Start:18682565
stop:18683705
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G28080AT Annotation by Michelle Graham. TAIR10: nodulin MtN21 /EamA-like transporter family protein | chr3:10451567-10455071 FORWARD LENGTH=304 SoyBaseE_val: 6.00E-23ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0019761GO-bp Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_B9SZH1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Auxin-induced protein 5NG4, putative n=1 Tax=Ricinus communis RepID=B9SZH1_RICCO SoyBaseE_val: 5.00E-29ISS
UniRef100_UPI000233F10FUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233F10F related cluster n=1 Tax=unknown RepID=UPI000233F10F SoyBaseE_val: 2.00E-64ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g18027 not represented in the dataset

Glyma12g18027 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g157000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma12g18027.1   sequence type=CDS   gene model=Glyma12g18027   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAAAATTGGATTGGAAAGCTAACAGTACTCAGGCCAAGTCCATTGGCACATTGGTATCAATCGCTGGAGCCTTAATAATTACTCTGTACAAAGGCCAAGCAGTCATAAAGAATCATCCATCAAATAAATTGTTCCCCAAAAAACATGTTTCATCTGAGCAATTTGACTGGGCAATAATTGGTGTATCCCTTCGAAGTATTGTTCATATATGGGTCATGAGCAAGAAGGGCCCTCTCTATGTGGCAATGTTTAAGCCAATTGGAATCATCTTTGCGGTCATCATAGGAATTGCCTTTCTTGGTGACTCTATCTATCTTGGAAGTGTGCTTGGAACAGCCATAGTGGTTATTGGTTTTTATGCTATTATTTGGGGGAAAAGCCAAGAGCAAGCAAAGGAAGAGTGTAAAGTCTATGATGACTCGGAATCATACTCGCCCATTGTCCCTCTTTTGGAGAACAAAAGAATGGAGGAATAG

>Glyma12g18027.1   sequence type=predicted peptide   gene model=Glyma12g18027   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEKLDWKANSTQAKSIGTLVSIAGALIITLYKGQAVIKNHPSNKLFPKKHVSSEQFDWAIIGVSLRSIVHIWVMSKKGPLYVAMFKPIGIIFAVIIGIAFLGDSIYLGSVLGTAIVVIGFYAIIWGKSQEQAKEECKVYDDSESYSPIVPLLENKRMEE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo