SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g17721): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g17721): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g17721

Feature Type:gene_model
Chromosome:Gm12
Start:18004936
stop:18009967
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G13790AT Annotation by Michelle Graham. TAIR10: AGAMOUS-like 15 | chr5:4449128-4450802 REVERSE LENGTH=268 SoyBaseE_val: 2.00E-57ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009556GO-bp Annotation by Michelle Graham. GO Biological Process: microsporogenesis SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009910GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of flower development SoyBaseN/AISS
GO:0010047GO-bp Annotation by Michelle Graham. GO Biological Process: fruit dehiscence SoyBaseN/AISS
GO:0010262GO-bp Annotation by Michelle Graham. GO Biological Process: somatic embryogenesis SoyBaseN/AISS
GO:0045487GO-bp Annotation by Michelle Graham. GO Biological Process: gibberellin catabolic process SoyBaseN/AISS
GO:0045892GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0048577GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of short-day photoperiodism, flowering SoyBaseN/AISS
GO:0052543GO-bp Annotation by Michelle Graham. GO Biological Process: callose deposition in cell wall SoyBaseN/AISS
GO:0060862GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of floral organ abscission SoyBaseN/AISS
GO:0060867GO-bp Annotation by Michelle Graham. GO Biological Process: fruit abscission SoyBaseN/AISS
GO:0071365GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to auxin stimulus SoyBaseN/AISS
GO:2000692GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of seed maturation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0042803GO-mf Annotation by Michelle Graham. GO Molecular Function: protein homodimerization activity SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
KOG0014 KOG MADS box transcription factor JGI ISS
PTHR11945Panther MADS BOX PROTEIN JGI ISS
PTHR11945:SF19Panther MADS BOX PROTEIN JGI ISS
PF00319PFAM SRF-type transcription factor (DNA-binding and dimerisation domain) JGI ISS
PF01486PFAM K-box region JGI ISS
UniRef100_Q67BK3UniRef Annotation by Michelle Graham. Best UniRef hit: AGL15 n=2 Tax=Glycine max RepID=Q67BK3_SOYBN SoyBaseE_val: 3.00E-130ISS
UniRef100_Q67BK3UniRef Annotation by Michelle Graham. Most informative UniRef hit: AGL15 n=2 Tax=Glycine max RepID=Q67BK3_SOYBN SoyBaseE_val: 3.00E-130ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g17721 not represented in the dataset

Glyma12g17721 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g142500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma12g17721.1   sequence type=CDS   gene model=Glyma12g17721   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTCGAGGGAAGATCGAGATCAAAAGAATCGACAATGCCAGCAGCAGGCAAGTCACGTTCTCGAAGCGGAGGACCGGGTTGTTCAAGAAGGCTCAGGAACTTTCCATTCTCTGTGAAGCCGAGGTTGCCGTCATAGTTTTCTCCAACACCGGCAAGCTCTTCGAGCTTTCCAGTTCTGGTATGAAGCGAACACTTTCAAGATACAACAAATGCCTTGGTTCTACAGATGCTGCTGTAGCAGAAATTAAGACAGATTCTAAGATGGTGGAGATTCTAAGAGAGGAAATTGCAGAGCTAGAAACAAAGCAATTGTATCTGGTGGGTAAGGATCTGACAGGATTGGGTTTAAAGGAATTGCAGAATTTAGAGCAGCAACTTAATGAGGGGTTATTGTCTGTCAAGGCGAGAAAGGAGGAATTACTCATGGAGCAACTAGAGCAATCTAGAGTTCAGATTGAGGAGCTTCGGTGTTTGTTTCCACAATCAGAACGAATGGTCCCATTCCAATACCAACATACTGAAGGAAAGAATACTTTTGTAGATACTGGTGCCAGATATCTCAACTTGGCCAATAACTGTGGAAATGAGAAAGGGAGTTCAGACACATCATTTCATTTGGGGTACTATGTTTTTCAATTACCACACTTTTAA

>Glyma12g17721.1   sequence type=predicted peptide   gene model=Glyma12g17721   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRGKIEIKRIDNASSRQVTFSKRRTGLFKKAQELSILCEAEVAVIVFSNTGKLFELSSSGMKRTLSRYNKCLGSTDAAVAEIKTDSKMVEILREEIAELETKQLYLVGKDLTGLGLKELQNLEQQLNEGLLSVKARKEELLMEQLEQSRVQIEELRCLFPQSERMVPFQYQHTEGKNTFVDTGARYLNLANNCGNEKGSSDTSFHLGYYVFQLPHF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo