SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g16400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g16400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g16400

Feature Type:gene_model
Chromosome:Gm12
Start:15598315
stop:15607318
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g16400
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G54750AT Annotation by Michelle Graham. TAIR10: Transport protein particle (TRAPP) component | chr5:22242080-22243477 FORWARD LENGTH=186 SoyBaseE_val: 3.00E-121ISS
GO:0006888GO-bp Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport SoyBaseN/AISS
GO:0030244GO-bp Annotation by Michelle Graham. GO Biological Process: cellulose biosynthetic process SoyBaseN/AISS
GO:0048193GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG3330 KOG Transport protein particle (TRAPP) complex subunit JGI ISS
PTHR13048Panther TRAFFICKING PROTEIN PARTICLE COMPLEX SUBUNIT 3 JGI ISS
PF04051PFAM Transport protein particle (TRAPP) component JGI ISS
UniRef100_B7FMN3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Trafficking protein particle complex subunit n=1 Tax=Medicago truncatula RepID=B7FMN3_MEDTR SoyBaseE_val: 5.00E-123ISS
UniRef100_I1LSM6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LSM6_SOYBN SoyBaseE_val: 9.00E-134ISS

Expression Patterns of Glyma12g16400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g16400 not represented in the dataset
Glyma12g16400 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma12g16400
ParalogEvidenceComments
Glyma06g42050 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma12g16400 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g135200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma12g16400
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g16400
>Glyma12g16400.1   sequence type=CDS   gene model=Glyma12g16400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTCCCGTCGCTCCTCGATCCGGTGATGCCATATTCGCCAACGTCGAACGCGTCAATGCGGAGCTGTTTACTTTGACGTATGGCGCAATTGTGCGTCAATTGCTCACGGATCTGGAAGAGGCTGAGGAGGTTAACAAGCAGCTTGATCAAATGGGTTACAATATTGGAATCCGTTTGATTGATGAGTTTTTAGCCAAGTCTAATGTCTCCAGATGCAACGATTTCAGAGAGACGACTGATGTTATTGCAAAGGTTGGTTTTAAAATGTTCCTCGGTGTTACTGCATCTGTGACCAATTGGGATGCTGATGGAACATGTTGTAGTATTGTTTTGGAGGATAATCCTTTGGTAGATTTTGTTGAGCTTCCTGACAACTGCCAAGGTTTGTACTATTGCAACATCTTAAGTGGAGTCATCAGAGGAGCCTTAGATATGGTGTCAATGAAAACTGAGGTAACTTGGCTTCGTGATGTGCTTCGCGGTGATGATGTGTTTGAGTTGCAGGTAAAACTTCTCAAGCATGTCCCAGAAGAGTATCCATACAAGGATGACGAGTGA
Predicted protein sequences of Glyma12g16400
>Glyma12g16400.1   sequence type=predicted peptide   gene model=Glyma12g16400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPPVAPRSGDAIFANVERVNAELFTLTYGAIVRQLLTDLEEAEEVNKQLDQMGYNIGIRLIDEFLAKSNVSRCNDFRETTDVIAKVGFKMFLGVTASVTNWDADGTCCSIVLEDNPLVDFVELPDNCQGLYYCNILSGVIRGALDMVSMKTEVTWLRDVLRGDDVFELQVKLLKHVPEEYPYKDDE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo