SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g16011

Feature Type:gene_model
Chromosome:Gm12
Start:15045301
stop:15046690
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g16011
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G21710AT Annotation by Michelle Graham. TAIR10: unknown protein; Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). | chr3:7648380-7649533 FORWARD LENGTH=211 SoyBaseE_val: 1.00E-12ISS
GO:0000041GO-bp Annotation by Michelle Graham. GO Biological Process: transition metal ion transport SoyBaseN/AISS
GO:0006826GO-bp Annotation by Michelle Graham. GO Biological Process: iron ion transport SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0010106GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion starvation SoyBaseN/AISS
GO:0010167GO-bp Annotation by Michelle Graham. GO Biological Process: response to nitrate SoyBaseN/AISS
GO:0010413GO-bp Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process SoyBaseN/AISS
GO:0015706GO-bp Annotation by Michelle Graham. GO Biological Process: nitrate transport SoyBaseN/AISS
GO:0045492GO-bp Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1KEI6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KEI6_SOYBN SoyBaseE_val: 2.00E-59ISS

Expression Patterns of Glyma12g16011
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g16011 not represented in the dataset
Glyma12g16011 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma12g16011
ParalogEvidenceComments
Glyma06g42360 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma12g16011 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g133300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma12g16011
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g16011
>Glyma12g16011.1   sequence type=CDS   gene model=Glyma12g16011   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTTCCATAACCAAAGCTCCTCCTTCCTCTAACGATGATATGTCAACTGAGGAGAGTGGTTGGACCACGTACTTTGATGACTTCTTCAACAACCATGTTGTTGATAACAACAAGTGTTCCATGTCTTTATCCGATGGTATAGCTAGCTCCTCCCTTGTCTCCGATGCTGCTTCTTTGGTAGACAAAAAAGTGGCTCATAGCAAACAAGTTGAGGAGTTTTATGTGAATAGAAATGTCAAGAGTTCATGTTTAAAGAAAAGGAAGGATGCAATAACGGCTTTGATTGATGACTCTTTGGAAGATACGGCAACTTCTCCTCTTAATAGTCCCAAGGTTTTGTATGTGAATCAGAAGATTGACAAGGCAAACAGACGGAAGTAG
Predicted protein sequences of Glyma12g16011
>Glyma12g16011.1   sequence type=predicted peptide   gene model=Glyma12g16011   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSITKAPPSSNDDMSTEESGWTTYFDDFFNNHVVDNNKCSMSLSDGIASSSLVSDAASLVDKKVAHSKQVEEFYVNRNVKSSCLKKRKDAITALIDDSLEDTATSPLNSPKVLYVNQKIDKANRRK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo