Report for Sequence Feature Glyma12g15880
Feature Type: gene_model
Chromosome: Gm12
Start: 14899980
stop: 14900248
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Expression Patterns of Glyma12g15880
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma12g15880 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma12g15880
Coding sequences of Glyma12g15880
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma12g15880.1 sequence type=CDS gene model=Glyma12g15880 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAAGTCTCAAACCTCCTGTATCACTTTAGACCGCCTCTTTCTTGCTTACTGTTGTTATGACTTTGCTCTAATGATGATACAGGGAATGCAATGA
Predicted protein sequences of Glyma12g15880
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma12g15880.1 sequence type=predicted peptide gene model=Glyma12g15880 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MKSQTSCITLDRLFLAYCCYDFALMMIQGMQ*