Glyma12g15840 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g15840

Feature Type:	gene_model
Chromosome:	Gm12
Start:	14828996
stop:	14830543
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma12g15840

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G28490	AT	Annotation by Michelle Graham. TAIR10: syntaxin of plants 61 \| chr1:10016634-10017842 FORWARD LENGTH=206	SoyBase	E_val: 3.00E-13	ISS
GO:0006623	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole	SoyBase	N/A	ISS
GO:0006886	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular protein transport	SoyBase	N/A	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0048193	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005802	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network	SoyBase	N/A	ISS
GO:0030140	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network transport vesicle	SoyBase	N/A	ISS
GO:0005484	GO-mf	Annotation by Michelle Graham. GO Molecular Function: SNAP receptor activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
UniRef100_F4HY64	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Syntaxin-61 n=1 Tax=Arabidopsis thaliana RepID=F4HY64_ARATH	SoyBase	E_val: 1.00E-10	ISS
UniRef100_I1LSJ9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LSJ9_SOYBN	SoyBase	E_val: 7.00E-146	ISS

Expression Patterns of Glyma12g15840

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g15840 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.12g132100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma12g15840

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma12g15840

Limit To All Plant Sequences

>Glyma12g15840.1   sequence type=CDS   gene model=Glyma12g15840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGAAACAGAGCAGGAAGAAGGAAAGAATGAAAGCAGTGGCAGACCAAAACGTGGAAGCAACAGACCAAGAAGCAGAATCCACCAATTCTGCAGAGCTGATTACCGTTAGATGCTGTCCCCTTCGGTTTTGCAATTTCACAATTCCTCCAAGACAAATAATGCCAAAATCTGTTAGGATTATACCTAGGGTTTGCAATAGAAATGTCTATAAATACAAAGAAAGTGTAATTCTAATGGATATGAATAATACAAGCTCGTTTCTAAAAAGAAAATGGGGGAGAATAAAGACTGGCAGTGCTAAAGAGTTTTGGGAAAATAATCAATCTCTGGTTTCTATTTTATTTTTGTCTTTTATTTTATCTATTGGTCCTGATAGGAGACAAGATGAGGAGTTGGATGAGCTTAGTTTAAGTGTACAAATAATAGGAGGTGTTGGACTTTCTATACATGAAGAGCTCCTTACTTTGAAGTGTGTCTCATTGTTTATGATATCAGAAAAAAGTGCCAATGGTCATGTAGAAGGCAGTGCAAATGACCAGATCATGATGATATTGGGTTTGTTGGCACTGTTCATTTTCCTCTTTATCTTGGTTTTCTTCACCTAG

Predicted protein sequences of Glyma12g15840

Limit To All Plant Sequences

>Glyma12g15840.1   sequence type=predicted peptide   gene model=Glyma12g15840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQKQSRKKERMKAVADQNVEATDQEAESTNSAELITVRCCPLRFCNFTIPPRQIMPKSVRIIPRVCNRNVYKYKESVILMDMNNTSSFLKRKWGRIKTGSAKEFWENNQSLVSILFLSFILSIGPDRRQDEELDELSLSVQIIGGVGLSIHEELLTLKCVSLFMISEKSANGHVEGSANDQIMMILGLLALFIFLFILVFFT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain