SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g15725): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g15725): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g15725

Feature Type:gene_model
Chromosome:Gm12
Start:14687305
stop:14692231
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G45890AT Annotation by Michelle Graham. TAIR10: senescence-associated gene 12 | chr5:18613300-18614759 FORWARD LENGTH=346 SoyBaseE_val: 2.00E-99ISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0007568GO-bp Annotation by Michelle Graham. GO Biological Process: aging SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009817GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus, incompatible interaction SoyBaseN/AISS
GO:0010150GO-bp Annotation by Michelle Graham. GO Biological Process: leaf senescence SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0010282GO-cc Annotation by Michelle Graham. GO Cellular Compartment: senescence-associated vacuole SoyBaseN/AISS
GO:0008234GO-mf Annotation by Michelle Graham. GO Molecular Function: cysteine-type peptidase activity SoyBaseN/AISS
KOG1543 KOG Cysteine proteinase Cathepsin L JGI ISS
PTHR12411Panther CYSTEINE PROTEASE FAMILY C1-RELATED JGI ISS
PTHR12411:SF44Panther CATHEPSIN L-RELATED JGI ISS
PF00112PFAM Papain family cysteine protease JGI ISS
PF08246PFAM Cathepsin propeptide inhibitor domain (I29) JGI ISS
UniRef100_A4PIZ3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cysteine proteinase n=1 Tax=Lotus japonicus RepID=A4PIZ3_LOTJA SoyBaseE_val: 9.00E-141ISS
UniRef100_UPI000233CBA3UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233CBA3 related cluster n=1 Tax=unknown RepID=UPI000233CBA3 SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g15725 not represented in the dataset

Glyma12g15725 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g131000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma12g15725.1   sequence type=CDS   gene model=Glyma12g15725   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCCATTGGCAAAAAGCAGCACATTTTAGCTCTTGTGCTCCTTCTCCCAATCTGCATTTCCCAAGTAATACATGAGCAATGGACGAAAAAATATGGAAAAGTATATAAGGATGCTGCTGAGAAGCAAAAACGTTTACTGATATTCAAAGACAATGTTGAATTCATTGAATCCTTCAATGCTGCCGGGAACAAACCTTACAAGCTTAGCATCAATCACCTCACTGACCAAACAAACGAGGAATTTGTGGCTTCCCATAATGGATACAAACACAAGGGATCACATTCGCAAACACCATTCAAATATGAAAACATCACTGTTGGATTGGAGGGAAAATGGAGCTGTCAAGCAATGAAGGACCAAGGCCAATGTGGTAACTGCTGGGCATTTTCAACGGTTGCGACAACAGAAGGTATCTACCAAATAACTACAAGTATGTTAATGTCCCTTTCGGAGCAAGAGTTAGTGGATTGCGACAGCGTGGATCATGGTTGTGATGGAGGTTACATGGAAGGTGGCAGTGAGGCAAACTACCCCTACACAGCAGTTGACGGAACTTATGACGCAAACAAAGAGGCTTCTCCTGCAGCTCAAATAAAGGGATATGAAACAGTACCTGCTAACAGTGAGGATGCACTGCAGAAAGCTGTTGCAAACCAACCCGTGTCAGTTACCATTGATGTCGGAGGATCCGCTTTCCAGTTCAACTCAAGTGGGGTTTTCACAGGACAATGTGGGACTCAACTAGACCATGGCGTTACTGCAGTTGGTTATGGTAGCACTGATGATGGCACTCAGTATTGGATTGTGAAGAATTCATGGGGCACACAATGGGGTGAAGAAGGTTACATAAGAATGCAACGAGGCACAGATGCCCAAGAAGGCCTATGTGGCATTGCCATGGATGCCTCGTACCCAACTGCTTAG

>Glyma12g15725.1   sequence type=predicted peptide   gene model=Glyma12g15725   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASIGKKQHILALVLLLPICISQVIHEQWTKKYGKVYKDAAEKQKRLLIFKDNVEFIESFNAAGNKPYKLSINHLTDQTNEEFVASHNGYKHKGSHSQTPFKYENITVGLEGKWSCQAMKDQGQCGNCWAFSTVATTEGIYQITTSMLMSLSEQELVDCDSVDHGCDGGYMEGGSEANYPYTAVDGTYDANKEASPAAQIKGYETVPANSEDALQKAVANQPVSVTIDVGGSAFQFNSSGVFTGQCGTQLDHGVTAVGYGSTDDGTQYWIVKNSWGTQWGEEGYIRMQRGTDAQEGLCGIAMDASYPTA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo