Glyma12g15410 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g15410): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g15410): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g15410

Feature Type:	gene_model
Chromosome:	Gm12
Start:	14239007
stop:	14240830
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma12g15410

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G58680	AT	Annotation by Michelle Graham. TAIR10: multiprotein bridging factor 1B \| chr3:21707367-21708625 FORWARD LENGTH=142	SoyBase	E_val: 6.00E-36	ISS
GO:0006351	GO-bp	Annotation by Michelle Graham. GO Biological Process: transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009723	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005730	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleolus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003713	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transcription coactivator activity	SoyBase	N/A	ISS
GO:0043565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding	SoyBase	N/A	ISS
KOG3398	KOG	Transcription factor MBF1	JGI		ISS
PTHR10245	Panther	ENDOTHELIAL DIFFERENTIATION-RELATED FACTOR 1 (MULTIPROTEIN BRIDGING FACTOR 1)	JGI		ISS
PF01381	PFAM	Helix-turn-helix	JGI		ISS
UniRef100_I1LSH1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LSH1_SOYBN	SoyBase	E_val: 1.00E-42	ISS
UniRef100_Q152U7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Multiprotein bridging factor 1c n=1 Tax=Solanum lycopersicum RepID=Q152U7_SOLLC	SoyBase	E_val: 6.00E-37	ISS

Expression Patterns of Glyma12g15410

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g15410 not represented in the dataset	Glyma12g15410 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g15410 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma12g15410

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma12g15410

Limit To All Plant Sequences

>Glyma12g15410.2   sequence type=CDS   gene model=Glyma12g15410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGGAAAGTTATCAAAGCTCTAAATCCATTTCCATCTTCGTTATTTTCTGCTCGTTGAGAAGCTTGCCAACGAAAGCTAAGAACCCTAGACAGTGTGGCCCTCTTTCTCTGGATTGGGAACCCGTCGTCCTCCGCAAGAAGGCTCCCACCGCTGCCGCTAAGAAGGACGAGAAAGCCGTACCAACTGAACTTAAGAAGGCTATAATGCAAGCTAGGATGGACAAAAAACTTACTCAGTCTCAGCTTGCTCAACTGATCAATAAGAAGCCTCAAGTGATTCAGGAGTACGAGTCAGGGAAGGCCATTCTAAACCAGCATATAATTGGCAAGTTGGGAAAAGTCCTTGGGGCTAAACTGCGCGACAAGAAATAA

Predicted protein sequences of Glyma12g15410

Limit To All Plant Sequences

>Glyma12g15410.2   sequence type=predicted peptide   gene model=Glyma12g15410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKESYQSSKSISIFVIFCSLRSLPTKAKNPRQCGPLSLDWEPVVLRKKAPTAAAKKDEKAVPTELKKAIMQARMDKKLTQSQLAQLINKKPQVIQEYESGKAILNQHIIGKLGKVLGAKLRDKK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain