SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g15410

Feature Type:gene_model
Chromosome:Gm12
Start:14239007
stop:14240830
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g15410
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G58680AT Annotation by Michelle Graham. TAIR10: multiprotein bridging factor 1B | chr3:21707367-21708625 FORWARD LENGTH=142 SoyBaseE_val: 6.00E-36ISS
GO:0006351GO-bp Annotation by Michelle Graham. GO Biological Process: transcription, DNA-dependent SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003713GO-mf Annotation by Michelle Graham. GO Molecular Function: transcription coactivator activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
KOG3398 KOG Transcription factor MBF1 JGI ISS
PTHR10245Panther ENDOTHELIAL DIFFERENTIATION-RELATED FACTOR 1 (MULTIPROTEIN BRIDGING FACTOR 1) JGI ISS
PF01381PFAM Helix-turn-helix JGI ISS
UniRef100_I1LSH1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LSH1_SOYBN SoyBaseE_val: 1.00E-42ISS
UniRef100_Q152U7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Multiprotein bridging factor 1c n=1 Tax=Solanum lycopersicum RepID=Q152U7_SOLLC SoyBaseE_val: 6.00E-37ISS

Expression Patterns of Glyma12g15410
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g15410 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma12g15410
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g15410
>Glyma12g15410.2   sequence type=CDS   gene model=Glyma12g15410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGGAAAGTTATCAAAGCTCTAAATCCATTTCCATCTTCGTTATTTTCTGCTCGTTGAGAAGCTTGCCAACGAAAGCTAAGAACCCTAGACAGTGTGGCCCTCTTTCTCTGGATTGGGAACCCGTCGTCCTCCGCAAGAAGGCTCCCACCGCTGCCGCTAAGAAGGACGAGAAAGCCGTACCAACTGAACTTAAGAAGGCTATAATGCAAGCTAGGATGGACAAAAAACTTACTCAGTCTCAGCTTGCTCAACTGATCAATAAGAAGCCTCAAGTGATTCAGGAGTACGAGTCAGGGAAGGCCATTCTAAACCAGCATATAATTGGCAAGTTGGGAAAAGTCCTTGGGGCTAAACTGCGCGACAAGAAATAA
Predicted protein sequences of Glyma12g15410
>Glyma12g15410.2   sequence type=predicted peptide   gene model=Glyma12g15410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKESYQSSKSISIFVIFCSLRSLPTKAKNPRQCGPLSLDWEPVVLRKKAPTAAAKKDEKAVPTELKKAIMQARMDKKLTQSQLAQLINKKPQVIQEYESGKAILNQHIIGKLGKVLGAKLRDKK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo