SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g15380

Feature Type:gene_model
Chromosome:Gm12
Start:14173749
stop:14175679
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g15380
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G64440AT Annotation by Michelle Graham. TAIR10: fatty acid amide hydrolase | chr5:25766229-25770260 FORWARD LENGTH=607 SoyBaseE_val: 1.00E-49ISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0070291GO-bp Annotation by Michelle Graham. GO Biological Process: N-acylethanolamine metabolic process SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0004040GO-mf Annotation by Michelle Graham. GO Molecular Function: amidase activity SoyBaseN/AISS
GO:0016884GO-mf Annotation by Michelle Graham. GO Molecular Function: carbon-nitrogen ligase activity, with glutamine as amido-N-donor SoyBaseN/AISS
GO:0047412GO-mf Annotation by Michelle Graham. GO Molecular Function: N-(long-chain-acyl)ethanolamine deacylase activity SoyBaseN/AISS
PTHR11895Panther AMIDASE JGI ISS
PTHR11895:SF7Panther GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT A JGI ISS
PF01425PFAM Amidase JGI ISS
UniRef100_B9RX50UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glutamyl-tRNA(Gln) amidotransferase subunit A, putative n=1 Tax=Ricinus communis RepID=B9RX50_RICCO SoyBaseE_val: 6.00E-57ISS
UniRef100_I1ME34UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1ME34_SOYBN SoyBaseE_val: 1.00E-74ISS

Expression Patterns of Glyma12g15380
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g15380 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma12g15380
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g15380
>Glyma12g15380.1   sequence type=CDS   gene model=Glyma12g15380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTAGTTGCAATTGTGGCTTCTAGATTATGTTCTGCTGCATTGGGAACTGATGGTGGAGGTTCAATCCGTATTCCTTCTTCCCTTTGTGGTGTGGTGGGATTTAAGAAAACTTATGGGCGGACAAACATGGAGGGGATCCATCGTAGTCATAATGTGATTCTGGGATTTGTATGCAATTCATATTTCTCTCTCTCTTTGATGCTTCATTTTTTACTTACTCTTTCATTCTACTTGACTGCTCTCAACTTTACATGTATTCTGCAATATTGGTCACCACCTTGTTTGCCAACTCTGTCATCCAACGATAATTCAAATGCCTTGGGATCTTTAAGAATCGGAAAGTACACCCCGTGGTTTAATGATGTGCATTCAACTGAAATCTCTTATAAATGTGATGAAGCACTTAATTTGCTGTCAAAGGCGCATGGTTGTGAAATGATAGAAATTATTATACTAGAGCTTCTTGAGATGCGAACTACCCATGTTGTTTCAATTGGCTCTGAATGCTTATGTTCACTGAATCCTGGT
Predicted protein sequences of Glyma12g15380
>Glyma12g15380.1   sequence type=predicted peptide   gene model=Glyma12g15380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LVAIVASRLCSAALGTDGGGSIRIPSSLCGVVGFKKTYGRTNMEGIHRSHNVILGFVCNSYFSLSLMLHFLLTLSFYLTALNFTCILQYWSPPCLPTLSSNDNSNALGSLRIGKYTPWFNDVHSTEISYKCDEALNLLSKAHGCEMIEIIILELLEMRTTHVVSIGSECLCSLNPG






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo