SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g15335

Feature Type:gene_model
Chromosome:Gm12
Start:14140701
stop:14141495
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g15335
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G61065AT Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF1218) | chr1:22490430-22491330 REVERSE LENGTH=180 SoyBaseE_val: 4.00E-18ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF06749PFAM Protein of unknown function (DUF1218) JGI ISS
UniRef100_I1LSG5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LSG5_SOYBN SoyBaseE_val: 1.00E-46ISS
UniRef100_Q6T7D3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Fiber protein Fb34 n=1 Tax=Gossypium barbadense RepID=Q6T7D3_GOSBA SoyBaseE_val: 5.00E-17ISS

Expression Patterns of Glyma12g15335
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g15335 not represented in the dataset
Glyma12g15335 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g15335 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g128500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma12g15335
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g15335
>Glyma12g15335.1   sequence type=CDS   gene model=Glyma12g15335   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAAAGACATATTCCCAGCTGGTGACATTTATAATTGCTGCTTCATGCCTTCTAGCGGATTCTGTGAGGAACGCGTACCACACCAAGTATCATGATCTCATGGGAGAGAGAGCACCTTCATGCCAGACCTTGAGGAAGGGAGTGTTTGGAGCTAGAGCTGCCTTCATTTTTTCAAAAGCTAATAATAAAGGTCCCCCTCCCTATGCTAAGGACACTGGTGTGAGGATGACCAATTTGTAG
Predicted protein sequences of Glyma12g15335
>Glyma12g15335.1   sequence type=predicted peptide   gene model=Glyma12g15335   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAKTYSQLVTFIIAASCLLADSVRNAYHTKYHDLMGERAPSCQTLRKGVFGARAAFIFSKANNKGPPPYAKDTGVRMTNL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo