SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g15250

Feature Type:gene_model
Chromosome:Gm12
Start:13987072
stop:13990728
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g15250
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G42610AT Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF640) | chr2:17748005-17748538 FORWARD LENGTH=177 SoyBaseE_val: 7.00E-89ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF04852PFAM Protein of unknown function (DUF640) JGI ISS
UniRef100_G7IU28UniRef Annotation by Michelle Graham. Most informative UniRef hit: 177 protein n=1 Tax=Medicago truncatula RepID=G7IU28_MEDTR SoyBaseE_val: 1.00E-90ISS
UniRef100_I1LSG2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LSG2_SOYBN SoyBaseE_val: 3.00E-129ISS

Expression Patterns of Glyma12g15250
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma12g15250
ParalogEvidenceComments
Glyma06g43040 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma12g15250 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g128100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma12g15250
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g15250
>Glyma12g15250.1   sequence type=CDS   gene model=Glyma12g15250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCCAGCAGTGGCAGTCACGGTACAGAAGGCTCATCAAGCAACATTCCCATAGAGTATCAGCAGCAGCAGCAGAGTCCAGTGACACTTAGCCGCTATGAGTCACAGAAGAGAAGGGACTGGAACACTTTTGGACAATACTTGAAGAACCAGAGACCCCCGGTACCTCTCTCTCAGTGCAATTGCAACCATGTGCTCGATTTCCTCCGTTATCTGGACCAGTTTGGCAAGACCAAGGTCCACCTTCAAGGGTGCATGTTCTATGGCCAGCCCGAACCCCCTGCGCCCTGCGCCTGCCCTCTTAGGCAGGCCTGGGGGAGTCTCGACGCCCTCATAGGCAGGCTCAGAGCTGCCTATGAGGAAAACGGAGGCTCCCCAGAGACTAACCCTTTTGCCAGCGGCTCAATCCGCGTCTACCTTAGGGAGGTCAGGGAGTGCCAGGCTAAGGCTAGAGGTATAGCTTACAAGAAGAAAAAGAAGACCACAAAGGAAAATGCTGAAGAATCATCAAACTCTTCCATCCACTTCTCTTGA
Predicted protein sequences of Glyma12g15250
>Glyma12g15250.1   sequence type=predicted peptide   gene model=Glyma12g15250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSSGSHGTEGSSSNIPIEYQQQQQSPVTLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYGQPEPPAPCACPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLREVRECQAKARGIAYKKKKKTTKENAEESSNSSIHFS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo