Glyma12g15186 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g15186

Feature Type:	gene_model
Chromosome:	Gm12
Start:	13876030
stop:	13878949
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma12g15186

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G31040	AT	Annotation by Michelle Graham. TAIR10: ATP synthase protein I -related \| chr2:13209094-13211012 REVERSE LENGTH=350	SoyBase	E_val: 7.00E-14	ISS
GO:0000023	GO-bp	Annotation by Michelle Graham. GO Biological Process: maltose metabolic process	SoyBase	N/A	ISS
GO:0019252	GO-bp	Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process	SoyBase	N/A	ISS
GO:0043085	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
UniRef100_G7JCK7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: ATP synthase protein I n=1 Tax=Medicago truncatula RepID=G7JCK7_MEDTR	SoyBase	E_val: 3.00E-13	ISS
UniRef100_I1KEN5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KEN5_SOYBN	SoyBase	E_val: 8.00E-31	ISS

Expression Patterns of Glyma12g15186

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g15186 not represented in the dataset	Glyma12g15186 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma12g15186

Paralog	Evidence	Comments
Glyma06g43060	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma12g15186 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma12g15186

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma12g15186

Limit To All Plant Sequences

>Glyma12g15186.1   sequence type=CDS   gene model=Glyma12g15186   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGCCTGGACAGTTTGGAAGTTGATTTGAGTAAAGAACCCGCAGCTCCAATAAATCATAATGCACACCAGCAAATTGATGCAGAAACTAATGTGATAGTAAGCAATAGGGTAAGATATAAATCAGCACCAATATGCCGCGAGCAAGAAAAATGGGATAGAGCTACCAAGGCAGCAATTGGAGGCAGTGATGTGGTGTTCCGGTAA

Predicted protein sequences of Glyma12g15186

Limit To All Plant Sequences

>Glyma12g15186.1   sequence type=predicted peptide   gene model=Glyma12g15186   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSLDSLEVDLSKEPAAPINHNAHQQIDAETNVIVSNRVRYKSAPICREQEKWDRATKAAIGGSDVVFR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain