|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G51550 | AT | Annotation by Michelle Graham. TAIR10: Malectin/receptor-like protein kinase family protein | chr3:19117877-19120564 REVERSE LENGTH=895 | SoyBase | E_val: 2.00E-31 | ISS |
GO:0000902 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell morphogenesis | SoyBase | N/A | ISS |
GO:0006007 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glucose catabolic process | SoyBase | N/A | ISS |
GO:0006096 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glycolysis | SoyBase | N/A | ISS |
GO:0006468 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein phosphorylation | SoyBase | N/A | ISS |
GO:0006833 | GO-bp | Annotation by Michelle Graham. GO Biological Process: water transport | SoyBase | N/A | ISS |
GO:0006972 | GO-bp | Annotation by Michelle Graham. GO Biological Process: hyperosmotic response | SoyBase | N/A | ISS |
GO:0007030 | GO-bp | Annotation by Michelle Graham. GO Biological Process: Golgi organization | SoyBase | N/A | ISS |
GO:0009266 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus | SoyBase | N/A | ISS |
GO:0009651 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to salt stress | SoyBase | N/A | ISS |
GO:0009791 | GO-bp | Annotation by Michelle Graham. GO Biological Process: post-embryonic development | SoyBase | N/A | ISS |
GO:0010193 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to ozone | SoyBase | N/A | ISS |
GO:0010483 | GO-bp | Annotation by Michelle Graham. GO Biological Process: pollen tube reception | SoyBase | N/A | ISS |
GO:0016049 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell growth | SoyBase | N/A | ISS |
GO:0030244 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellulose biosynthetic process | SoyBase | N/A | ISS |
GO:0046686 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cadmium ion | SoyBase | N/A | ISS |
GO:0046777 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein autophosphorylation | SoyBase | N/A | ISS |
GO:0048193 | GO-bp | Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport | SoyBase | N/A | ISS |
GO:0048767 | GO-bp | Annotation by Michelle Graham. GO Biological Process: root hair elongation | SoyBase | N/A | ISS |
GO:0050832 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to fungus | SoyBase | N/A | ISS |
GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
GO:0043680 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: filiform apparatus | SoyBase | N/A | ISS |
GO:0004672 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein kinase activity | SoyBase | N/A | ISS |
GO:0004674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity | SoyBase | N/A | ISS |
GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
GO:0016301 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: kinase activity | SoyBase | N/A | ISS |
GO:0016772 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups | SoyBase | N/A | ISS |
PF11721 | PFAM | Di-glucose binding within endoplasmic reticulum | JGI | ISS | |
UniRef100_C6ZRM8 | UniRef | Annotation by Michelle Graham. Best UniRef hit: FERONIA receptor-like kinase n=1 Tax=Glycine max RepID=C6ZRM8_SOYBN | SoyBase | E_val: 3.00E-101 | ISS |
UniRef100_C6ZRM8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: FERONIA receptor-like kinase n=1 Tax=Glycine max RepID=C6ZRM8_SOYBN | SoyBase | E_val: 3.00E-101 | ISS |
Glyma12g14486 not represented in the dataset |
Glyma12g14486 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.12g123300 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma12g14486.1 sequence type=CDS gene model=Glyma12g14486 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAGGCTCCTTAGCATCATCACCACCTCCTTAACACTGTTCTTCCTTCTTCTCTTTCTCTCCATACACCTCCAAGCGTATACCCTAGAAGACAACTTCACCATCAGTTGTGGCACCACCGGGATAGTATTCGACGACGAAAGGACATGGACGGGGGACGCAGACACAAAATACTTATCTGGTGGTCAAGGCAGAACCGTTTTAACTGAAGCAACAACACAAGATCCTTCTGTCAATCAAGTTCCCTACACCACAGCACGGTTATCCCGTTCTCAGTTCAATTACTCCTTCCCCGTTTCTGCGGGCCCCAAATTCGTTCGCCTCTTCTTCTACCCAGCTTATTACCCTTCCTTTCCCCGCACTGATGCCTCTTTCTCCGTTCAATCTAACGGATTCACCTTCTTAAAAGGTTTCAACGCCTCTCTAAACGCTGACGCGGAAGCCACCAAAACCATCTTCAGGGAATATGTGGTAAACATCAACGATGGTGAGATTCTCATCCTCAGCTTCACTCCCTCGCAACCAAACTCCTACGCTTTCATCAATGGAATCGAGGATACGTATCCAGCCGTATCCGTGGAGTATCGGTATCGGATACGAAGTGGTGTGAGCAGCGGTGATTGGCAAAGTTGGCACTGA
>Glyma12g14486.1 sequence type=predicted peptide gene model=Glyma12g14486 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MRLLSIITTSLTLFFLLLFLSIHLQAYTLEDNFTISCGTTGIVFDDERTWTGDADTKYLSGGQGRTVLTEATTQDPSVNQVPYTTARLSRSQFNYSFPVSAGPKFVRLFFYPAYYPSFPRTDASFSVQSNGFTFLKGFNASLNADAEATKTIFREYVVNINDGEILILSFTPSQPNSYAFINGIEDTYPAVSVEYRYRIRSGVSSGDWQSWH*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||