Glyma12g14320 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g14320

Feature Type:	gene_model
Chromosome:	Gm12
Start:	13205669
stop:	13206388
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma12g14320

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G31090	AT	Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G20562.1); Has 70 Blast hits to 70 proteins in 13 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 70; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). \| chr2:13256282-13256595 FORWARD LENGTH=75	SoyBase	E_val: 2.00E-30	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_I1LSA8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LSA8_SOYBN	SoyBase	E_val: 9.00E-45	ISS

Expression Patterns of Glyma12g14320

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g14320 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.12g122200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma12g14320

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma12g14320

Limit To All Plant Sequences

>Glyma12g14320.1   sequence type=CDS   gene model=Glyma12g14320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGCAACTCAGACGGAGATTGCAGGTCATTGGGTTTTCTGCTGGGTCTTCCCTTTGCCTTTCTCTCCCTCCTCCTCTCAATCGTTGGTCTAATTGTATGGATTGTTGGATTGTTGCTGACATGCATATGCCCCTGCTGCTTGTGCCTGACCGTAATAGTGGAGCTTGCGTTAGCATTGGTGAAGGCTCCACTGCATGTCATGGAGTGGTTCACTTCTCAGATCCCTTGCTGA

Predicted protein sequences of Glyma12g14320

Limit To All Plant Sequences

>Glyma12g14320.1   sequence type=predicted peptide   gene model=Glyma12g14320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCNSDGDCRSLGFLLGLPFAFLSLLLSIVGLIVWIVGLLLTCICPCCLCLTVIVELALALVKAPLHVMEWFTSQIPC*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain