SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g14190

Feature Type:gene_model
Chromosome:Gm12
Start:12931081
stop:12932140
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g14190
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G42360AT Annotation by Michelle Graham. TAIR10: RING/U-box superfamily protein | chr2:17640907-17641617 FORWARD LENGTH=236 SoyBaseE_val: 3.00E-49ISS
GO:0002679GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response SoyBaseN/AISS
GO:0006865GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid transport SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0015824GO-bp Annotation by Michelle Graham. GO Biological Process: proline transport SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0043090GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid import SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0004842GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR22764Panther RING FINGER PROTEIN 11 (SID 1669) (NEDD4 WW DOMAIN-BINDING PROTEIN 2). JGI ISS
PF00097PFAM Zinc finger, C3HC4 type (RING finger) JGI ISS
UniRef100_G7ZVJ1UniRef Annotation by Michelle Graham. Most informative UniRef hit: RING finger family protein n=1 Tax=Medicago truncatula RepID=G7ZVJ1_MEDTR SoyBaseE_val: 3.00E-55ISS
UniRef100_I1LSA3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LSA3_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma12g14190
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma12g14190
ParalogEvidenceComments
Glyma06g43730 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma12g14190 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g121400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma12g14190
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g14190
>Glyma12g14190.1   sequence type=CDS   gene model=Glyma12g14190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATGTCTTCGACAACGATCACGACCATGACGAACCATTTGTTCGATACCACAGTAACGTTAACAGAACAATACTGTACGTGTCCATGGTTTCCTTCATAACAGTCTTGTTTCTCGTCTTCGCACTCTACCTCTACGCCCGGTGCGTCCTAAGGGGCCGGTCCCGCAACCGCGCCGCCATTCGACGTCTCACCATCGCCGCGCTTCACGTCTCTGACCTCGACGCAGCCGCCGCCGCACACCGACACGCCGAACCACCCAACGCGGGCCTCGACCCTGCCATCATAGCGTCGCTTCCAACCTTCGCCTCCAGAACGAAGGTTCTAGAAAATGGTGGTGATGGTGGCGGAGGAGGGGCCACCGTGGTGGAGTGTGCTGTGTGCTTGAGTGCTCTAGAAGGTGAAGAAAAGGCCAAGTTGCTTCCCAACTGCAACCACTTTTTTCACGTGGATTGCATTGATAAGTGGCTGGGTTCCCACTCCACATGTCCTATTTGTCGAGCCGAGGTGAAGCCGCAGCTTCAACCACAGCATCGTGAGGGTCCTGTGGGTCTTTCTCTTCACAGTGCACGTACACTGCTCAGTAGGGTGGATGGTGATGATGATAATAACAACAATGATAACGAATCATCAAAAATTAATGATTCTAATTCACGGTTGAGCTCGTTTAGGAGGATTCTCAGTAGGCAAAGATCTTCAAGAAGAGTCCAACCGTCTGGCCACGATGATGAGGATGGTGGTGTTGATCAAGATTTGGAGAGACAGTGA
Predicted protein sequences of Glyma12g14190
>Glyma12g14190.1   sequence type=predicted peptide   gene model=Glyma12g14190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDVFDNDHDHDEPFVRYHSNVNRTILYVSMVSFITVLFLVFALYLYARCVLRGRSRNRAAIRRLTIAALHVSDLDAAAAAHRHAEPPNAGLDPAIIASLPTFASRTKVLENGGDGGGGGATVVECAVCLSALEGEEKAKLLPNCNHFFHVDCIDKWLGSHSTCPICRAEVKPQLQPQHREGPVGLSLHSARTLLSRVDGDDDNNNNDNESSKINDSNSRLSSFRRILSRQRSSRRVQPSGHDDEDGGVDQDLERQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo