Glyma12g13800 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g13800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g13800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g13800

Feature Type:	gene_model
Chromosome:	Gm12
Start:	12443399
stop:	12444327
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma12g13800

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G11200	AT	Annotation by Michelle Graham. TAIR10: DEAD/DEAH box RNA helicase family protein \| chr5:3567389-3570686 FORWARD LENGTH=486	SoyBase	E_val: 5.00E-35	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0004386	GO-mf	Annotation by Michelle Graham. GO Molecular Function: helicase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0008026	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP-dependent helicase activity	SoyBase	N/A	ISS
PTHR24031	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24031:SF5	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00270	PFAM	DEAD/DEAH box helicase	JGI		ISS
UniRef100_G7JB35	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DEAD-box ATP-dependent RNA helicase n=1 Tax=Medicago truncatula RepID=G7JB35_MEDTR	SoyBase	E_val: 4.00E-33	ISS
UniRef100_UPI000233CD4F	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233CD4F related cluster n=1 Tax=unknown RepID=UPI000233CD4F	SoyBase	E_val: 1.00E-43	ISS

Expression Patterns of Glyma12g13800

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g13800 not represented in the dataset	Glyma12g13800 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g13800 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma12g13800

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma12g13800

Limit To All Plant Sequences

>Glyma12g13800.1   sequence type=CDS   gene model=Glyma12g13800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TCGAGATTTCAAGACTTGTTGTTGAAACCAAAGCTTCTTCAAGCCATTGATTCATCCACTACAATTTTGTATGCTTCTTCATTATTGCGACACGAATGCATCCCTCAAGCAATCTTAGGAATGGATGTCGTTTGCCAAGCGAAATCTGGGATGGGAAATACTGCTGTTTTTGTTTTGTCAACACTTCAGCAAGCTGATCCTGTTCCGGATCAAGTTGCGGCTCTTGTTCTTTGCCACACAAGAGAACTGGCTTATCAG

Predicted protein sequences of Glyma12g13800

Limit To All Plant Sequences

>Glyma12g13800.1   sequence type=predicted peptide   gene model=Glyma12g13800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SRFQDLLLKPKLLQAIDSSTTILYASSLLRHECIPQAILGMDVVCQAKSGMGNTAVFVLSTLQQADPVPDQVAALVLCHTRELAYQ

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain