|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G11200 | AT | Annotation by Michelle Graham. TAIR10: DEAD/DEAH box RNA helicase family protein | chr5:3567389-3570686 FORWARD LENGTH=486 | SoyBase | E_val: 5.00E-35 | ISS |
| GO:0005618 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cell wall | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
| GO:0003676 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding | SoyBase | N/A | ISS |
| GO:0004386 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: helicase activity | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| GO:0008026 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP-dependent helicase activity | SoyBase | N/A | ISS |
| PTHR24031 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PTHR24031:SF5 | Panther | SUBFAMILY NOT NAMED | JGI | ISS | |
| PF00270 | PFAM | DEAD/DEAH box helicase | JGI | ISS | |
| UniRef100_G7JB35 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: DEAD-box ATP-dependent RNA helicase n=1 Tax=Medicago truncatula RepID=G7JB35_MEDTR | SoyBase | E_val: 4.00E-33 | ISS |
| UniRef100_UPI000233CD4F | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233CD4F related cluster n=1 Tax=unknown RepID=UPI000233CD4F | SoyBase | E_val: 1.00E-43 | ISS |
|
Glyma12g13800 not represented in the dataset |
Glyma12g13800 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma12g13800.1 sequence type=CDS gene model=Glyma12g13800 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high TCGAGATTTCAAGACTTGTTGTTGAAACCAAAGCTTCTTCAAGCCATTGATTCATCCACTACAATTTTGTATGCTTCTTCATTATTGCGACACGAATGCATCCCTCAAGCAATCTTAGGAATGGATGTCGTTTGCCAAGCGAAATCTGGGATGGGAAATACTGCTGTTTTTGTTTTGTCAACACTTCAGCAAGCTGATCCTGTTCCGGATCAAGTTGCGGCTCTTGTTCTTTGCCACACAAGAGAACTGGCTTATCAG
>Glyma12g13800.1 sequence type=predicted peptide gene model=Glyma12g13800 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high SRFQDLLLKPKLLQAIDSSTTILYASSLLRHECIPQAILGMDVVCQAKSGMGNTAVFVLSTLQQADPVPDQVAALVLCHTRELAYQ
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||