Glyma12g13360 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g13360): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g13360): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g13360

Feature Type:	gene_model
Chromosome:	Gm12
Start:	11751726
stop:	11756831
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma12g13360

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G42770	AT	Annotation by Michelle Graham. TAIR10: Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein \| chr2:17798635-17799927 REVERSE LENGTH=232	SoyBase	E_val: 3.00E-87	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005778	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: peroxisomal membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009536	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG1944	KOG	Peroxisomal membrane protein MPV17 and related proteins	JGI		ISS
PTHR11266	Panther	PEROXISOMAL MEMBRANE PROTEIN 2, PXMP2	JGI		ISS
PTHR11266:SF4	Panther	PXMP-2 - RELATED	JGI		ISS
PF04117	PFAM	Mpv17 / PMP22 family	JGI		ISS
UniRef100_G7JTW9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein Mpv17 n=1 Tax=Medicago truncatula RepID=G7JTW9_MEDTR	SoyBase	E_val: 2.00E-107	ISS
UniRef100_UPI000233CBED	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233CBED related cluster n=1 Tax=unknown RepID=UPI000233CBED	SoyBase	E_val: 3.00E-133	ISS

Expression Patterns of Glyma12g13360

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g13360 not represented in the dataset	Glyma12g13360 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma12g13360

Paralog	Evidence	Comments
Glyma06g44390	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma12g13360 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.12g117300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma12g13360

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma12g13360

Limit To All Plant Sequences

>Glyma12g13360.2   sequence type=CDS   gene model=Glyma12g13360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACGCTATTGGGAGTGGTAATTGGGGGTTCTGGCAGTGGAATCCGTTACCGCAGTCTCGACGAAGTCGTATTCGCTCCAAGTCGGGTTCGGCGGATGCGACCGGTGGAGGCGGTTACCGATTTTTGGCGAAGCAGGCAGTGACCGCCGCGTCCCTAACCCTCACCGGCGACACAATCCCTCAACTCAGCAACCATTGGAGGAAAGCAAAGGAAGGTGGTGGCAAACTTGATTGGCTGCATGCTCTGCGAATGACTTCATATGGATTCCTTTTATATGGTCCTGGTTCTTATGCCTGGTACCAGTGCCTTGACCACTTTCTCCCCAAACCAACAGTCCAGAATCTAATGTTAAAGGTTTTACTAAACCAGATTGTGTTAGGTCCATGTGTCATTGCTGTTGTTTTTGCATGGAATAATTTATGGCTAAGGAAGCTCTCTCAGCTTCCAGAAAAATACAGAAGAGATGCTTTTCCAACGTTACTTTATGGATTTAGATTCTGGATCCCAGTCACTGTATTAAATTTCTGGGTGGTTCCTCTTCAAGCCCGAGTGGCTTTCATGTCAATGGGCTCAGTATTTTGGAATTTCTACTTGTCATCAACAATAACCAAGTAA

Predicted protein sequences of Glyma12g13360

Limit To All Plant Sequences

>Glyma12g13360.2   sequence type=predicted peptide   gene model=Glyma12g13360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDAIGSGNWGFWQWNPLPQSRRSRIRSKSGSADATGGGGYRFLAKQAVTAASLTLTGDTIPQLSNHWRKAKEGGGKLDWLHALRMTSYGFLLYGPGSYAWYQCLDHFLPKPTVQNLMLKVLLNQIVLGPCVIAVVFAWNNLWLRKLSQLPEKYRRDAFPTLLYGFRFWIPVTVLNFWVVPLQARVAFMSMGSVFWNFYLSSTITK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain