|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT2G39730 | AT | Annotation by Michelle Graham. TAIR10: rubisco activase | chr2:16571174-16573345 REVERSE LENGTH=441 | SoyBase | E_val: 6.00E-31 | ISS |
GO:0000165 | GO-bp | Annotation by Michelle Graham. GO Biological Process: MAPK cascade | SoyBase | N/A | ISS |
GO:0006612 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane | SoyBase | N/A | ISS |
GO:0009409 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cold | SoyBase | N/A | ISS |
GO:0009416 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to light stimulus | SoyBase | N/A | ISS |
GO:0009595 | GO-bp | Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus | SoyBase | N/A | ISS |
GO:0009637 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to blue light | SoyBase | N/A | ISS |
GO:0009644 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to high light intensity | SoyBase | N/A | ISS |
GO:0009697 | GO-bp | Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process | SoyBase | N/A | ISS |
GO:0009744 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus | SoyBase | N/A | ISS |
GO:0009753 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus | SoyBase | N/A | ISS |
GO:0009814 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response, incompatible interaction | SoyBase | N/A | ISS |
GO:0009862 | GO-bp | Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway | SoyBase | N/A | ISS |
GO:0009867 | GO-bp | Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway | SoyBase | N/A | ISS |
GO:0010114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to red light | SoyBase | N/A | ISS |
GO:0010150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: leaf senescence | SoyBase | N/A | ISS |
GO:0010155 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of proton transport | SoyBase | N/A | ISS |
GO:0010200 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to chitin | SoyBase | N/A | ISS |
GO:0010218 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to far red light | SoyBase | N/A | ISS |
GO:0010310 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process | SoyBase | N/A | ISS |
GO:0010363 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response | SoyBase | N/A | ISS |
GO:0019684 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction | SoyBase | N/A | ISS |
GO:0031348 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response | SoyBase | N/A | ISS |
GO:0042742 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to bacterium | SoyBase | N/A | ISS |
GO:0043900 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process | SoyBase | N/A | ISS |
GO:0050832 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to fungus | SoyBase | N/A | ISS |
GO:0005618 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cell wall | SoyBase | N/A | ISS |
GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
GO:0009535 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane | SoyBase | N/A | ISS |
GO:0009570 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma | SoyBase | N/A | ISS |
GO:0009579 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: thylakoid | SoyBase | N/A | ISS |
GO:0009941 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope | SoyBase | N/A | ISS |
GO:0010287 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule | SoyBase | N/A | ISS |
GO:0010319 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: stromule | SoyBase | N/A | ISS |
GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
GO:0048046 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: apoplast | SoyBase | N/A | ISS |
GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
GO:0030234 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: enzyme regulator activity | SoyBase | N/A | ISS |
GO:0043531 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ADP binding | SoyBase | N/A | ISS |
GO:0046863 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ribulose-1,5-bisphosphate carboxylase/oxygenase activator activity | SoyBase | N/A | ISS |
PTHR11603 | Panther | AAA FAMILY ATPASE | JGI | ISS | |
PTHR11603:SF153 | Panther | JGI | ISS | ||
UniRef100_D4N5G0 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Alpha-form rubisco activase n=1 Tax=Glycine max RepID=D4N5G0_SOYBN | SoyBase | E_val: 6.00E-41 | ISS |
UniRef100_UPI0002336B6F | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI0002336B6F related cluster n=1 Tax=unknown RepID=UPI0002336B6F | SoyBase | E_val: 6.00E-42 | ISS |
Glyma12g13030 not represented in the dataset |
Glyma12g13030 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma12g13030.1 sequence type=CDS gene model=Glyma12g13030 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATTAAGGAAAATCCTTCCAATGCGAGCTTGTCTTTGCCAAGATGGGAATCAATTGAACATAGGATTAAAATATGTTTTTGCAGACATGATCAAGAAGGGAAAGATGTGTGCTCTCTTCATATTTTAGGCTGCACTCCAAGGATTGTGGCAGCCGATGTGGGACTTAAGTATTTCCCAATACTTATCCTATCACATCATATATCTCAGCTATCATGCCTACACTTTTCTCTAGATTTATTTGGTGCTCTCAGGGCTAAAGTGTATGATGATGAGGTGAGGAAGTGGATTTTTGTTATTGGTGTTGACTTCATTGGGAAGAAGCTTGTGAACTCCAAGGAAGGACCTCCAACCTTTGACCAACCGAAGATGACTTTGAGCAAGCTCTTGGAAGTACAACTAGCAGACAAGTACTTGAAAGAGGCTGCTCTTGGTGATGCTAATCAAGATTCCATCAATAGAGGAACTTTCTATGATGTGTGGGATCTGGTGGTGAACGGACTTGATCCGTTGCCGGCGAATCCAATCGCTGCGCAACAAGCGATATATAGAGATGCGAAGAAGAAGGATTGCAAAGGCTTGTGCATTCTGCATTAG
>Glyma12g13030.1 sequence type=predicted peptide gene model=Glyma12g13030 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high IKENPSNASLSLPRWESIEHRIKICFCRHDQEGKDVCSLHILGCTPRIVAADVGLKYFPILILSHHISQLSCLHFSLDLFGALRAKVYDDEVRKWIFVIGVDFIGKKLVNSKEGPPTFDQPKMTLSKLLEVQLADKYLKEAALGDANQDSINRGTFYDVWDLVVNGLDPLPANPIAAQQAIYRDAKKKDCKGLCILH*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||