Glyma12g13005 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g13005): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g13005): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g13005

Feature Type:	gene_model
Chromosome:	Gm12
Start:	11376976
stop:	11378490
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma12g13005

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G51830	AT	Annotation by Michelle Graham. TAIR10: pfkB-like carbohydrate kinase family protein \| chr5:21069709-21071450 FORWARD LENGTH=343	SoyBase	E_val: 8.00E-68	ISS
GO:0006014	GO-bp	Annotation by Michelle Graham. GO Biological Process: D-ribose metabolic process	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0004747	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ribokinase activity	SoyBase	N/A	ISS
GO:0016301	GO-mf	Annotation by Michelle Graham. GO Molecular Function: kinase activity	SoyBase	N/A	ISS
GO:0016773	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphotransferase activity, alcohol group as acceptor	SoyBase	N/A	ISS
PTHR10584	Panther	SUGAR KINASE RELATED	JGI		ISS
PTHR10584:SF34	Panther	RIBOKINASE-RELATED	JGI		ISS
PF00294	PFAM	pfkB family carbohydrate kinase	JGI		ISS
UniRef100_G7KQE8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Fructokinase n=1 Tax=Medicago truncatula RepID=G7KQE8_MEDTR	SoyBase	E_val: 3.00E-73	ISS
UniRef100_I1L3G2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L3G2_SOYBN	SoyBase	E_val: 1.00E-84	ISS

Expression Patterns of Glyma12g13005

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g13005 not represented in the dataset	Glyma12g13005 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g13005 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma12g13005

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma12g13005

Limit To All Plant Sequences

>Glyma12g13005.1   sequence type=CDS   gene model=Glyma12g13005   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGAGTCAATCCAATGATCTCACAAAAGAAGATTGCAAGGAAACAAGTTCAGTGGTTGTTTGTTTCGGGGAAATGTTAATAGACTTTGTTCCACTGGTGGGAGGAGTGTCACTAGCTGAAGCACCCGCTTTCAAGAAAGCTCCTGGTGGTGCTCCTACCAATGTGGCTATTGGTATCTCTAGACTAGGAAGTTCATCTCCTTTCATAGGCAAGGTTGGAGCAGATGAATTTGGGTACATGTTGGCTAACATTTTAAAGCTGAACAATGTTGAGACTTCTGGCATGCGGTTTGACCCTAATGCAAGAATTGCATTAGCTTTTGTTACACTTAGAGTAGATGGCGAACGCGAGTTCTTGTTTTTCCGCAATCCAAGCGCTGATATGCTCCTTCAAGAGTTAGAACTTGATAAAGATTTCCTTAAGTAG

Predicted protein sequences of Glyma12g13005

Limit To All Plant Sequences

>Glyma12g13005.1   sequence type=predicted peptide   gene model=Glyma12g13005   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQSQSNDLTKEDCKETSSVVVCFGEMLIDFVPLVGGVSLAEAPAFKKAPGGAPTNVAIGISRLGSSSPFIGKVGADEFGYMLANILKLNNVETSGMRFDPNARIALAFVTLRVDGEREFLFFRNPSADMLLQELELDKDFLK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain