|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G47250 | AT | Annotation by Michelle Graham. TAIR10: RNA helicase family protein | chr2:19399923-19402981 REVERSE LENGTH=729 | SoyBase | E_val: 2.00E-37 | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0009941 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
| GO:0003676 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding | SoyBase | N/A | ISS |
| GO:0003724 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: RNA helicase activity | SoyBase | N/A | ISS |
| GO:0004386 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: helicase activity | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| GO:0008026 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP-dependent helicase activity | SoyBase | N/A | ISS |
| GO:0017111 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity | SoyBase | N/A | ISS |
| PTHR10641 | Panther | MYB-RELATED | JGI | ISS | |
| UniRef100_G7ICV1 | UniRef | Annotation by Michelle Graham. Best UniRef hit: ATP-dependent RNA helicase-like protein n=1 Tax=Medicago truncatula RepID=G7ICV1_MEDTR | SoyBase | E_val: 4.00E-38 | ISS |
| UniRef100_G7ICV1 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: ATP-dependent RNA helicase-like protein n=1 Tax=Medicago truncatula RepID=G7ICV1_MEDTR | SoyBase | E_val: 4.00E-38 | ISS |
|
Glyma12g12990 not represented in the dataset |
Glyma12g12990 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.12g114800 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma12g12990.1 sequence type=CDS gene model=Glyma12g12990 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGGAAGGAAACCTTTCTGTGCCAAAGTTGGGTTGAAGAAGGGGCCATGGACCGTAGAGGAGGACAAGAAGCTCATAAGCTTGATCCTCAATAATGGCCAATGTTGTTGGAGAGTTGTTCCTAAGCTATTATGCATCACTGATTTCAATAGTCGTGACTACTATGTCAACATTAGAAAGGAAATGTTCATGCAGGTGGCCCATTTGGAGCGGACAGGACATTTACTTGACAATGAAAAACAACCGGGTTTGTTATTGGTGCACTTGCATCCATCAAATTGCCTGGACCACAAGCCGGAGTTAATGGATGTAGCCCCACATTACTATGATTTGTCGAATTTTCCACAATGTGAAGCGAAGTGTGTTCTTGAGAGGCTTTACAAGAAGCGAGAAAAGGAAAAGGAGGAAGCCAAGAGTCGTAAATGA
>Glyma12g12990.1 sequence type=predicted peptide gene model=Glyma12g12990 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MGRKPFCAKVGLKKGPWTVEEDKKLISLILNNGQCCWRVVPKLLCITDFNSRDYYVNIRKEMFMQVAHLERTGHLLDNEKQPGLLLVHLHPSNCLDHKPELMDVAPHYYDLSNFPQCEAKCVLERLYKKREKEKEEAKSRK*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||