SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g12350): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g12350): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g12350

Feature Type:gene_model
Chromosome:Gm12
Start:10569899
stop:10575580
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G28250AT Annotation by Michelle Graham. TAIR10: expansin B3 | chr4:14000446-14001945 REVERSE LENGTH=264 SoyBaseE_val: 2.00E-138ISS
GO:0006949GO-bp Annotation by Michelle Graham. GO Biological Process: syncytium formation SoyBaseN/AISS
GO:0009664GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization SoyBaseN/AISS
GO:0009826GO-bp Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth SoyBaseN/AISS
GO:0009828GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall loosening SoyBaseN/AISS
GO:0010583GO-bp Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone SoyBaseN/AISS
GO:0019953GO-bp Annotation by Michelle Graham. GO Biological Process: sexual reproduction SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
PF01357PFAM Pollen allergen JGI ISS
PF03330PFAM Rare lipoprotein A (RlpA)-like double-psi beta-barrel JGI ISS
UniRef100_H9TN49UniRef Annotation by Michelle Graham. Best UniRef hit: Expansin B protein n=1 Tax=Glycine max RepID=H9TN49_SOYBN SoyBaseE_val: 0ISS
UniRef100_H9TN49UniRef Annotation by Michelle Graham. Most informative UniRef hit: Expansin B protein n=1 Tax=Glycine max RepID=H9TN49_SOYBN SoyBaseE_val: 0ISS

LocusGene SymbolProtein Name
EXPB7 beta-expansin gene 7

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g12350 not represented in the dataset

Glyma12g12350 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma06g44930 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g111200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma12g12350.1   sequence type=CDS   gene model=Glyma12g12350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGCTCCACCGTGTCTCCGCCGCATCGAAACTGAGCCTCACGTGCCTCAGCCTCGCCTTGAAACTCGTGCTGTTGTACGCCGCGGAGGCACAGCTTCAGCACCGTGGCCCCGACCTACATTGGTACCCCGGAACCGCCACCTGGTACGGCGACCCCGAAGGAGACGGCAGTACCGGTGGGGCATGTGGGTATGGTACGATGGTGGATGTGAAGCCGTTCAGGGCGCGGGTGGGAGCTTTGGGGCCATTGCTGTTCATGAAGGGGGAAGGGTGTGGTGCGTGCTACAAGGTGAAGTGTTTGGACAAGAGCATATGTTCGAGAAGAGCAGTGACAGTGATAATTACGGACGAGTGCCCCGGTTGCCCCTCTGACCAAACACACTTCGATCTCAGTGGTGCCGCGTTTGGCCGCATGGCTATTGCTGGCGAGAACGGTCCACTCAGAGACCGTGGTCAAATCCCCGTCATTTACCGCAGAACACCTTGTAAATATCCAGGAAGAAAAATTGCCTTTCATGTTAACGAAGGCTCCACCCCATTTTGGCTATCACTTCTGGTTGAATTTGAGGACGCAGAGGGAGATATTGGCTCCATGCATATACGAGAAGCAGGGTCTACTGAGTGGCTACAAATGAATCACCTTTGGGGTGCAAATTGGTGCATTATTGGAGGACCTTTAAGGGGACCATTCTCAGTGAAATTGAGCTCTTCCACTGGGAGAAGCCTCTCTGCAAGAGATGTTATTCCAACCAATTGGGTTCCAAAGGCCACTTACACCTCTCGCCTAAATTTCTACCCCTAG

>Glyma12g12350.1   sequence type=predicted peptide   gene model=Glyma12g12350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQLHRVSAASKLSLTCLSLALKLVLLYAAEAQLQHRGPDLHWYPGTATWYGDPEGDGSTGGACGYGTMVDVKPFRARVGALGPLLFMKGEGCGACYKVKCLDKSICSRRAVTVIITDECPGCPSDQTHFDLSGAAFGRMAIAGENGPLRDRGQIPVIYRRTPCKYPGRKIAFHVNEGSTPFWLSLLVEFEDAEGDIGSMHIREAGSTEWLQMNHLWGANWCIIGGPLRGPFSVKLSSSTGRSLSARDVIPTNWVPKATYTSRLNFYP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo