SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g12300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g12300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g12300

Feature Type:gene_model
Chromosome:Gm12
Start:10501248
stop:10503940
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G51000AT Annotation by Michelle Graham. TAIR10: alpha/beta-Hydrolases superfamily protein | chr3:18945258-18946499 REVERSE LENGTH=323 SoyBaseE_val: 3.00E-65ISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004301GO-mf Annotation by Michelle Graham. GO Molecular Function: epoxide hydrolase activity SoyBaseN/AISS
KOG4178 KOG Soluble epoxide hydrolase JGI ISS
PTHR10992Panther ALPHA/BETA HYDROLASE RELATED JGI ISS
PTHR10992:SF279Panther EPOXIDE HYDROLASE-RELATED JGI ISS
PF00561PFAM alpha/beta hydrolase fold JGI ISS
UniRef100_D8L7V9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Epoxide hydrolase 3 n=1 Tax=Prunus persica RepID=D8L7V9_PRUPE SoyBaseE_val: 0ISS
UniRef100_UPI000233C726UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C726 related cluster n=1 Tax=unknown RepID=UPI000233C726 SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g12300 not represented in the dataset

Glyma12g12300 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma06g44990 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g110700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma12g12300.2   sequence type=CDS   gene model=Glyma12g12300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTCTCGGTTCTCACCCATTTCCTTACTCTTTCACTCTACTTTTCAGACAACACTCTTACCCCTCCTTGTATGATGGAGAAGATCCAGCACAGTGAGGTGGAAGTAAAGGGACTGAAGCTGCACGTGGCAGAGATTGGAAGTGGCTCCAAGGCAGTGGTGTTCTTGCATGGATTCCCAGAGATCTGGTACACATGGAGGCACCAAATGATTGCTGTGGCAAATGCTGGTTATAGGGCAATTGCCTTTGATTTCAGAGGCTATGGACTCTCTGAGCAACCAGCAGAGCCTGAAAAGGAAACCATGTTTGATCTGGTTCATGAAATAGTGGGTCTTTTGGATGCTTTAAGCATCAGCAAGGCTTTCCTTGTTGGCAAGGATTTTGGTGCCATCCCAGGACATCTTACTACTGCAGTACACCCAGAAAGAGTAGCTGGTATCATAACTTTAGGCATTCCTTTCATGCTCCCGGGTCCCTCTGCAGTGGAGAGCCACCTTCTGCTCCCCAAAGGGTTTTATATTACTAGGTGGCGGGAGCCTGGGAGGGCAGAAGCAGATTTTGGCCGCTTTCCTGTGAAATCAGTGATAAGGAACATCTACATTCTCTTCTCTAGAAGTGAGGTTCCAATAGCAGCTGATGATCAAGAAATCATGGACTTGTTTGACCCATCTACTGCCCTACCTCCATGGTTCTCTGAGGAAGACCTTGCAACATATGCATCATTATATGAAAAATCTGGATTCAAATATGCATTGCAGGTTCCTTACAGGAGTATTAATGTGGATGCTGGCTTAAGTGATGTAAAAGTTACTATTCCATCACTTCTGATCATGGGTGAGAAAGATTATGTGTTCAAGTTTCCAGGCATGGAGGACTATATTCGAAGTGGGGCAGTGAAAAATTTTGTGCCGGACTTGGAAATCGTGTATATTCCAGAAGGAAGCCATTTTGTGCATGAACAAATGCCAGAGAAGGTGAACCAGTTCATCATTGAGTTCCTTGACAAACAAAATATATGA

>Glyma12g12300.2   sequence type=predicted peptide   gene model=Glyma12g12300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFSVLTHFLTLSLYFSDNTLTPPCMMEKIQHSEVEVKGLKLHVAEIGSGSKAVVFLHGFPEIWYTWRHQMIAVANAGYRAIAFDFRGYGLSEQPAEPEKETMFDLVHEIVGLLDALSISKAFLVGKDFGAIPGHLTTAVHPERVAGIITLGIPFMLPGPSAVESHLLLPKGFYITRWREPGRAEADFGRFPVKSVIRNIYILFSRSEVPIAADDQEIMDLFDPSTALPPWFSEEDLATYASLYEKSGFKYALQVPYRSINVDAGLSDVKVTIPSLLIMGEKDYVFKFPGMEDYIRSGAVKNFVPDLEIVYIPEGSHFVHEQMPEKVNQFIIEFLDKQNI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo