SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g12240

Feature Type:gene_model
Chromosome:Gm12
Start:10400969
stop:10401381
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Expression Patterns of Glyma12g12240
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g12240 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma12g12240
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g12240
>Glyma12g12240.1   sequence type=CDS   gene model=Glyma12g12240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTTTACAGCAAGTAGAATCTCTTGAAACACTTCCTAAATCTGTGGGAAAGAAATCATATTGTTGTAGAAACAAACTATCATGTGGTTTAAATAAAATGAAAGAACAAAGTAGCTTAAATGAAATAAAATTTGCATAA
Predicted protein sequences of Glyma12g12240
>Glyma12g12240.1   sequence type=predicted peptide   gene model=Glyma12g12240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTLQQVESLETLPKSVGKKSYCCRNKLSCGLNKMKEQSSLNEIKFA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo